Endosymbiont of Acanthamoeba sp. UWC8: I862_06615 Help Entry I862_06615        CDS       T03255                                  Symbol rpmH Name (GenBank) 50S ribosomal protein L34   KO K02914   large subunit ribosomal protein L34 Organism eaa  Endosymbiont of Acanthamoeba sp. UWC8 Pathway eaa03010   Ribosome Brite KEGG Orthology (KO) [BR:eaa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     I862_06615 (rpmH)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:eaa03011]     I862_06615 (rpmH) Ribosome [BR:eaa03011]  Ribosomal proteins   Mitochondria/ Chloroplast    Large subunit     I862_06615 (rpmH)   Bacteria     I862_06615 (rpmH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L34 Motif Other DBs NCBI-ProteinID:  AIF81877 LinkDB All DBs Position complement(1363646..1363786) Genome browser AA seq 46 aa AA seqDB search MATKRTYQPSNLVKKRRGGFRARMATVGGRKVINARRAKGRHVLSA NT seq 141 nt NT seq  +upstreamnt  +downstreamnt atggcaactaaaagaacgtatcagccgagtaatttagtgaaaaaacgcagaggcggattt agagccagaatggcgaccgtaggcggcagaaaagtaataaacgctagaagagcgaagggt agacacgttttaagcgcgtaa

DBGET integrated database retrieval system