Endosymbiont of Acanthamoeba sp. UWC8: I862_07555 Help Entry I862_07555        CDS       T03255                                  Symbol rpsU Name (GenBank) 30S ribosomal protein S21   KO K02970   small subunit ribosomal protein S21 Organism eaa  Endosymbiont of Acanthamoeba sp. UWC8 Pathway eaa03010   Ribosome Brite KEGG Orthology (KO) [BR:eaa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     I862_07555 (rpsU)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:eaa03011]     I862_07555 (rpsU) Ribosome [BR:eaa03011]  Ribosomal proteins   Mitochondria/ Chloroplast    Small subunit     I862_07555 (rpsU)   Bacteria     I862_07555 (rpsU) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S21 Motif Other DBs NCBI-ProteinID:  AIF82065 UniProt:  A0A075MLQ2 LinkDB All DBs Position complement(1594167..1594301) Genome browser AA seq 44 aa AA seqDB search MQREGVFKVMKMGRFYEKPSEVRVRKGQEAFRRRRKLDRKRNYD NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgcaaagagaaggcgtttttaaagttatgaagatgggtcgtttctacgaaaaaccttcc gaagttcgagttcgtaaaggacaagaagcctttagaagaagaagaaaattagacaggaaa agaaattatgattaa

DBGET integrated database retrieval system