Escherichia coli ABU 83972: ECABU_c10880 Help Entry ECABU_c10880      CDS       T01995                                  Name (GenBank) putative acyl-carrier protein   KO K02078   acyl carrier protein Organism eab  Escherichia coli ABU 83972 Pathway eab01100   Metabolic pathways eab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECABU_c10880    00074 Mycolic acid biosynthesis     ECABU_c10880   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECABU_c10880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADN45657 LinkDB All DBs Position complement(1130247..1130444) Genome browser AA seq 65 aa AA seqDB search MTPDDIDINAPLFGDGLGLDSIDALELGLAVKNEYGIVLSAESEEMRQHFFSVATLASFI AAQRA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt ttgactcctgatgatattgatatcaatgcgccactgtttggcgacggtttagggctggac tctatcgatgcactggaactgggactggcagtaaaaaatgagtacggcatcgtgctctct gcggaaagcgaagaaatgcgtcagcactttttctccgtcgccactctggcctctttcatt gctgcgcaacgtgcctga

DBGET integrated database retrieval system