Escherichia coli ABU 83972: ECABU_c33830 Help Entry ECABU_c33830      CDS       T01995                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism eab  Escherichia coli ABU 83972 Pathway eab01100   Metabolic pathways eab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECABU_c33830    00074 Mycolic acid biosynthesis     ECABU_c33830   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECABU_c33830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADN47847 LinkDB All DBs Position 3452040..3452267 Genome browser AA seq 75 aa AA seqDB search MDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPINILLDVKT PAQLMETLLPWLENK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggattacatcctttcctgtttacaggatttggtcgaaaacggtgtggaaattaagccc gacagcgatctcgtcaacgatcttggcctggagtcgatcaaagtgatggatctcttaatg atgctggaagacagattcgatatttccattcctattaatattctgctggatgtcaaaacc cctgcgcaattaatggaaactctacttccatggctggagaataaataa

DBGET integrated database retrieval system