Peptoclostridium acidaminophilum: EAL2_808p05030 Help Entry EAL2_808p05030    CDS       T03061                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism eac  Peptoclostridium acidaminophilum Pathway eac00020   Citrate cycle (TCA cycle) eac00720   Other carbon fixation pathways eac01100   Metabolic pathways eac01110   Biosynthesis of secondary metabolites eac01120   Microbial metabolism in diverse environments eac01200   Carbon metabolism eac01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:eac00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     EAL2_808p05030   09102 Energy metabolism    00720 Other carbon fixation pathways     EAL2_808p05030 Enzymes [BR:eac01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      EAL2_808p05030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_10 Fer4_6 Fer4_2 Fer4_21 Fer4_9 Fer4_15 Fer4_8 Fer4_13 Fer4_16 Fer4_4 Fer4_17 Fer4_3 Fer4_22 zf-C2H2_11 Motif Other DBs NCBI-ProteinID:  AHM58006 UniProt:  W8UB43 LinkDB All DBs Position EAL2_808p:complement(508720..508917) Genome browser AA seq 65 aa AA seqDB search MKVKVDAIRCKQCELCAANCPKKAITFSEEINEFGYQTVVVDHEKCIGCGICYTMCPDGV YEILG NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgaaggtaaaggttgatgcaataagatgcaagcagtgcgagctttgcgcggcaaactgc cctaaaaaagccataacattttctgaggaaataaacgagtttggttatcaaactgtagtt gtggatcatgaaaaatgcataggctgcggcatatgctatactatgtgtcctgacggcgta tatgaaattctaggatag

DBGET integrated database retrieval system