Klebsiella aerogenes KCTC 2190: EAE_15585 Help Entry EAE_15585         CDS       T01529                                  Name (GenBank) anti-sigma28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism eae  Klebsiella aerogenes KCTC 2190 Pathway eae02020   Two-component system eae02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:eae00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     EAE_15585  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     EAE_15585  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:eae02035]     EAE_15585 Bacterial motility proteins [BR:eae02035]  Flagellar system   Flagellar assembly proteins    Others     EAE_15585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Tir_receptor_M Motif Other DBs NCBI-ProteinID:  AEG98028 UniProt:  A0A0H3FQW9 LinkDB All DBs Position complement(3369384..3369707) Genome browser AA seq 107 aa AA seqDB search MSIDRTQRLQPVSTVQPRETPADNPLQPRKATAAETAVSATKVKLSDAQARLMQPGTQDI DMNRVEAIKQAIRSGELKMDAGKIADALLQDAHNDIQRLAGSKTDKA NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgagtatcgatcgcacccagcggttacagccggtttccacggtgcagccgcgtgaaacc ccggccgacaacccgcttcagccgcgcaaggccaccgcggcggaaaccgccgttagcgcc accaaagtgaaactgagcgatgcgcaggcgcggctgatgcagccgggcacccaggatatt gatatgaaccgggtcgaggctatcaaacaggcgattcgtagcggcgagctgaaaatggac gcgggcaaaatcgccgacgccctgctgcaggatgcgcacaacgatatccagcgccttgcc ggtagcaaaacagataaggcctga

DBGET integrated database retrieval system