Klebsiella aerogenes KCTC 2190: EAE_16285 Help Entry EAE_16285         CDS       T01529                                  Name (GenBank) DNA-damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism eae  Klebsiella aerogenes KCTC 2190 Brite KEGG Orthology (KO) [BR:eae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:eae03400]     EAE_16285 DNA repair and recombination proteins [BR:eae03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     EAE_16285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI MinE COG4_m Motif Other DBs NCBI-ProteinID:  AEG98168 UniProt:  A0A0H3FR92 LinkDB All DBs Position complement(3515811..3516056) Genome browser AA seq 81 aa AA seqDB search MRIEVSIAKTTALPNGALEALNNELAKRIAHYYPERENQVTVRYAAGNNLSVIGGLKEDK DRISEILQETWESADDWFIHD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgcatcgaagtgtcaattgccaaaaccacagccttacccaacggcgcgctggaagcg ctgaataacgaactcgctaagcgtatcgctcactattaccctgaacgtgaaaaccaggtc acggtacgttatgccgccggcaataatttatctgtcatcggtggcctgaaagaagacaaa gaccggattagcgaaatcctgcaggaaacctgggaaagcgccgacgactggtttatccac gactaa

DBGET integrated database retrieval system