Eurytemora carolleeae: 111699311 Help Entry 111699311         CDS       T07296                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism eaf  Eurytemora carolleeae Pathway eaf04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:eaf00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     111699311  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:eaf01009]     111699311   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eaf04131]     111699311    03036 Chromosome and associated proteins [BR:eaf03036]     111699311   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eaf04147]     111699311 Protein phosphatases and associated proteins [BR:eaf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      111699311 Membrane trafficking [BR:eaf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     111699311 Chromosome and associated proteins [BR:eaf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      111699311 Exosome [BR:eaf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111699311 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH DUF748 Motif Other DBs NCBI-GeneID:  111699311 NCBI-ProteinID:  XP_023325721 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MRRAGQNPTDVEVQDLLNNIDNGSGTIDFEDFLVVMREKVREIDLEIHFKDTFRVFSKDE DGCIPADELKFVMNHLPGKINYKEIEEMIETVDRNGDGRISYSEFR NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgagacgagctggtcagaatcctacagatgttgaagttcaagatttactcaataatatt gataatggcagtggaactattgattttgaggattttcttgttgtaatgagagagaaggtt cgagaaatagatctagaaatacatttcaaggatacgttcagagtcttcagcaaggatgag gatggttgtattcctgctgatgaactaaagtttgtgatgaaccatttaccaggaaagata aactataaagagattgaggagatgattgaaacagtggataggaatggagatggtagaatt agctatagtgagttcaggtag

DBGET integrated database retrieval system