Eurytemora carolleeae: 111701076 Help Entry 111701076         CDS       T07296                                  Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism eaf  Eurytemora carolleeae Pathway eaf04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:eaf00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     111701076  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:eaf01009]     111701076   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eaf04131]     111701076    03036 Chromosome and associated proteins [BR:eaf03036]     111701076   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eaf04147]     111701076 Protein phosphatases and associated proteins [BR:eaf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      111701076 Membrane trafficking [BR:eaf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     111701076 Chromosome and associated proteins [BR:eaf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      111701076 Exosome [BR:eaf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111701076 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 EF-hand_8 AIF-1 EH Motif Other DBs NCBI-GeneID:  111701076 NCBI-ProteinID:  XP_023327987 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MGDQMEPEEFKSYQAAFDAFDWGHNGKIKYSSLQAAMRRAGQNPTDVEVLDIINKIDDDS GCLDFQEFCYIMTEQNKQADQETGYKETFRVFSKDEEGCIPAEEIK NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgggagaccagatggaaccagaggagtttaaatcctaccaggcggcctttgatgctttt gactggggacacaatgggaaaataaaatacagttcacttcaggccgctatgcgaagagct ggtcaaaaccctaccgatgttgaagttctagatatcattaacaaaatagatgatgactca gggtgcctggattttcaggaattctgctatatcatgacggaacagaataagcaggcagat caagaaactggatacaaagaaaccttcagagtattcagtaaagatgaggagggttgtatt ccagcagaggaaatcaagtaa

DBGET integrated database retrieval system