Eurytemora affinis: 111707290 Help Entry 111707290         CDS       T07296                                  Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism eaf  Eurytemora affinis Brite KEGG Orthology (KO) [BR:eaf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eaf03036]     111707290 Chromosome and associated proteins [BR:eaf03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      111707290     MLL-HCF complex      111707290     MLL3/MLL4 complex      111707290 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 RIIa Motif Other DBs NCBI-GeneID:  111707290 NCBI-ProteinID:  XP_023336139 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MAGKDDSSAAKKPKTDSSDIKSMTSKQYLDQMVVPQLLKALTAVSTERPQDPIQFLADYL LKHKDDVSETESVSSS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggccgggaaagatgatagttctgcggccaaaaagccgaaaacagattcctctgatatc aagtccatgacaagtaaacaatatctagatcagatggtggttccacagttgcttaaagca ctcacagcggtgagcacagaacgaccccaggatcctattcagttcttggccgactacctc cttaaacataaagatgacgtatcagaaacagaatctgtttcatcttcatag

DBGET integrated database retrieval system