Eurytemora carolleeae: 111712525 Help Entry 111712525         CDS       T07296                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism eaf  Eurytemora carolleeae Pathway eaf04814   Motor proteins Brite KEGG Orthology (KO) [BR:eaf00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     111712525  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:eaf03037]     111712525    04812 Cytoskeleton proteins [BR:eaf04812]     111712525 Cilium and associated proteins [BR:eaf03037]  Motile cilia and associated proteins   Dynein arm    111712525 Cytoskeleton proteins [BR:eaf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      111712525 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 DUF7917 Motif Other DBs NCBI-GeneID:  111712525 NCBI-ProteinID:  XP_023342940 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MADQPTEETQFVVDEVSNVIKEAIETTIGGNSYTHSKVSQWTNGVVESCLASLTKLQKPF KYIVSCVIMQKNGAGLHTASSCYWDNSTDGSCTVRWENKTMYCIVSVFGLAI NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggcggatcaacctacagaggaaactcagtttgttgtggacgaggtgtcgaatgttatc aaagaagccattgagacaaccattggaggaaatagctatacgcattccaaagtaagtcag tggaccaacggagttgttgaatcttgcttagctagtttaaccaagcttcagaaacctttt aaatatattgtttcatgtgttattatgcagaagaatggtgctggtttgcacacagctagt tcctgctactgggacaattcaacagacgggagttgtactgtcagatgggagaacaagacg atgtactgtatagtttctgtctttggtttggcaatctag

DBGET integrated database retrieval system