Eurytemora affinis: 111715065 Help Entry 111715065         CDS       T07296                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism eaf  Eurytemora affinis Pathway eaf04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:eaf00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     111715065  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:eaf01009]     111715065   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eaf04131]     111715065    03036 Chromosome and associated proteins [BR:eaf03036]     111715065   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eaf04147]     111715065 Protein phosphatases and associated proteins [BR:eaf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      111715065 Membrane trafficking [BR:eaf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     111715065 Chromosome and associated proteins [BR:eaf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      111715065 Exosome [BR:eaf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111715065 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_6 EF-hand_7 MmeI_hel Motif Other DBs NCBI-GeneID:  111715065 NCBI-ProteinID:  XP_023346079 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MARYFREQDIDEYRECFYLYARSGTVSTMDQLTVIMRSLGMSPTIPELKVYMREKNGKIA FSDFLEIMHTHSKKENIPKELIQAFKNMDTQRKGTIPARDLWNILVKWGEKLSPKEGGLL LL NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggcccgttatttccgcgagcaagatattgacgagtatagagaatgtttctatctgtat gcaaggtccggtacagtgtctacaatggaccaactaaccgtcattatgagatccctgggc atgtccccgactatccctgagctgaaggtgtacatgagggagaagaacgggaagattgcg ttctccgatttcttggagatcatgcatacacacagtaaaaaggagaatataccgaaggag ttaatacaagctttcaagaacatggatactcagagaaaaggaactattcctgctagagat ttatggaacatacttgtcaagtggggagagaagcttagtcctaaagaaggtggattatta ttattataa

DBGET integrated database retrieval system