Ensifer adhaerens Casida A: FA04_04335 Help Entry FA04_04335        CDS       T04507                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eah  Ensifer adhaerens Casida A Pathway eah01100   Metabolic pathways eah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eah00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FA04_04335    00074 Mycolic acid biosynthesis     FA04_04335   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FA04_04335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  ANK71924 UniProt:  A0A069HJP2 LinkDB All DBs Position 916549..916785 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgtcgacgcc gaaaaggtcagcgaaggcgcaagcttcatcgacgacctcggcgcggactcgctcgacacc gtcgaactggtcatggctttcgaagaagaattcggcgttgaaatcccggacgacgctgct gactcgatcctgactgtcggcgacgccgtcaagttcatcgaaaaggctcaggcctaa

DBGET integrated database retrieval system