Equus asinus (ass): 106822242 Help Entry 106822242         CDS       T04645                                  Name (RefSeq) metallothionein-1B   KO K14739   metallothionein 1/2 Organism eai  Equus asinus (ass) Pathway eai04978   Mineral absorption Brite KEGG Orthology (KO) [BR:eai00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     106822242  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:eai03019]     106822242    03029 Mitochondrial biogenesis [BR:eai03029]     106822242 Messenger RNA biogenesis [BR:eai03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      106822242 Mitochondrial biogenesis [BR:eai03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     106822242 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  106822242 NCBI-ProteinID:  XP_014682839 UniProt:  A0A8C4LAC3 LinkDB All DBs Position 28:36145686..36146636 Genome browser AA seq 61 aa AA seqDB search MDPNCSCVAGESCTCAGSCKCKQCRCASCKKSCCSCCPVGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgtcgccggtgaatcctgcacctgcgccggctcctgcaaa tgcaaacagtgcagatgcgcctcctgcaagaagagctgctgctcctgctgccccgtgggc tgtgccaagtgtgcccagggctgcgtctgcaaaggggcatcggacaagtgcagctgctgc gcctga

DBGET integrated database retrieval system