Equus asinus (ass): 106823476 Help Entry 106823476         CDS       T04645                                  Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism eai  Equus asinus (ass) Pathway eai04613   Neutrophil extracellular trap formation eai05034   Alcoholism eai05203   Viral carcinogenesis eai05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:eai00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106823476  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     106823476   09163 Immune disease    05322 Systemic lupus erythematosus     106823476   09165 Substance dependence    05034 Alcoholism     106823476  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eai03036]     106823476   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eai04147]     106823476 Chromosome and associated proteins [BR:eai03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106823476 Exosome [BR:eai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106823476 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  106823476 NCBI-ProteinID:  XP_014684674 UniProt:  A0A9L0IAB9 LinkDB All DBs Position 8:complement(103918320..103919004) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagagcccgccaagtctgcccctgccccgaagaagggttccaagaaggcggtgacc aaggtccagaaaaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccatc tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgcagtgtcggagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system