Equus asinus (ass): 106825648 Help Entry 106825648         CDS       T04645                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism eai  Equus asinus (ass) Pathway eai04015   Rap1 signaling pathway eai04810   Regulation of actin cytoskeleton eai05014   Amyotrophic lateral sclerosis eai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     106825648 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     106825648 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106825648 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106825648 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eai04131]     106825648 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:eai04812]     106825648 (PFN1)    04147 Exosome [BR:eai04147]     106825648 (PFN1) Membrane trafficking [BR:eai04131]  Others   Actin-binding proteins    Others     106825648 (PFN1) Cytoskeleton proteins [BR:eai04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      106825648 (PFN1) Exosome [BR:eai04147]  Exosomal proteins   Proteins found in most exosomes    106825648 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  106825648 NCBI-ProteinID:  XP_014688031 LinkDB All DBs Position 13:complement(15203772..15206724) Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggagaatttaccatggatcttcgtaccaagagcaccggcggagcccccaccttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system