Equus asinus (ass): 106826287 Help Entry 106826287         CDS       T04645                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism eai  Equus asinus (ass) Pathway eai04081   Hormone signaling eai04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     106826287 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     106826287 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eai04052]     106826287 (GAST) Cytokines and neuropeptides [BR:eai04052]  Neuropeptides   GPCR binding    106826287 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  106826287 NCBI-ProteinID:  XP_014689020 UniProt:  A0A9L0IB44 LinkDB All DBs Position 13:43617565..43618210 Genome browser AA seq 107 aa AA seqDB search MRRLCVYVLIFALALAAFSEASWKPCSQLQDAPSGPGANKGLEPHWPDQLDRLGPASHHR RQLGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDFGRRSAEEGDQSP NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgcggcgactgtgtgtgtatgtgctgatctttgcgctggctctggccgccttctccgaa gcttcttggaagccctgctcccagctgcaggacgcaccctcaggtccaggggccaataag ggcctggagccgcattggccagaccagctggacaggctgggcccagcctctcatcaccga aggcagctggggctccagggttccccacacttggtagcagacctgtccaagaagcaaggg ccatggctggagaaagaagaagcagcctacggatggatggactttggccgccgcagcgct gaggaaggggatcaaagtccttag

DBGET integrated database retrieval system