Equus asinus (ass): 106826414 Help Entry 106826414         CDS       T04645                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism eai  Equus asinus (ass) Pathway eai04014   Ras signaling pathway eai04137   Mitophagy - animal eai04144   Endocytosis eai04145   Phagosome eai04148   Efferocytosis eai04962   Vasopressin-regulated water reabsorption eai05132   Salmonella infection eai05146   Amoebiasis eai05152   Tuberculosis Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     106826414 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106826414 (RAB5C)    04145 Phagosome     106826414 (RAB5C)    04137 Mitophagy - animal     106826414 (RAB5C)    04148 Efferocytosis     106826414 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     106826414 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106826414 (RAB5C)    05152 Tuberculosis     106826414 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     106826414 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eai04131]     106826414 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eai04147]     106826414 (RAB5C)    04031 GTP-binding proteins [BR:eai04031]     106826414 (RAB5C) Membrane trafficking [BR:eai04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     106826414 (RAB5C)  Endosome - Lysosome transport     106826414 (RAB5C) Exosome [BR:eai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106826414 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    106826414 (RAB5C)   Exosomal proteins of colorectal cancer cells    106826414 (RAB5C)   Exosomal proteins of bladder cancer cells    106826414 (RAB5C) GTP-binding proteins [BR:eai04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     106826414 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  106826414 NCBI-ProteinID:  XP_014689229 UniProt:  A0A9L0JAU1 LinkDB All DBs Position 13:complement(43911029..43932613) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcacgacccaacggaccagccgctgggaacaagatctgt caatttaagctggtcctgctgggggagtccgcagtcggcaaatccagcctcgtcctccgc tttgtcaagggacaattccacgagtaccaggagagcacaattggagcggccttcctcaca cagactgtctgcttggacgacacaacagtcaagtttgagatctgggacacagccggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tatgacatcaccaacacagatacgtttgcacgcgccaagaactgggtgaaagagttacag aggcaggccagccccaacattgtcattgcgctcgcgggtaacaaggcggacctggccagc aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc atggagacatcggcaaagactgcaatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaatgagccccagaatgcagctggtgctccaggccggaaccgaggagtg gacctccaggagaacaacccagccagccggagccagtgctgtagcaactga

DBGET integrated database retrieval system