Equus asinus (ass): 106826905 Help Entry 106826905         CDS       T04645                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism eai  Equus asinus (ass) Pathway eai04621   NOD-like receptor signaling pathway eai05012   Parkinson disease eai05132   Salmonella infection eai05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eai00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106826905 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106826905 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     106826905 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     106826905 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:eai03110]     106826905 (TXN) Chaperones and folding catalysts [BR:eai03110]  Protein folding catalysts   Protein disulfide isomerase    106826905 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  106826905 NCBI-ProteinID:  XP_014689972 UniProt:  A0A9L0JNW1 LinkDB All DBs Position 10:31291253..31306073 Genome browser AA seq 105 aa AA seqDB search MVKQIESKSAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVAAECEVKCMPTFQFFKKGQKVDEFSGANKEKLEATIKGLI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtctgcttttcaggaggccttgaacagtgcaggagaa aagctcgtagtcgttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattccctctctgaaaagtactccaatgtggtgttccttgaagtagacgtggat gactgtcaggatgttgctgcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaaggggcaaaaggtggatgagttttctggagctaataaggaaaaacttgaagccacc attaagggattaatctaa

DBGET integrated database retrieval system