Equus asinus (ass): 106828357 Help Entry 106828357         CDS       T04645                                  Symbol RAB1A Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism eai  Equus asinus (ass) Pathway eai04140   Autophagy - animal eai05014   Amyotrophic lateral sclerosis eai05022   Pathways of neurodegeneration - multiple diseases eai05134   Legionellosis Brite KEGG Orthology (KO) [BR:eai00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106828357 (RAB1A)  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     106828357 (RAB1A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106828357 (RAB1A)    05022 Pathways of neurodegeneration - multiple diseases     106828357 (RAB1A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eai04131]     106828357 (RAB1A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eai04147]     106828357 (RAB1A)    04031 GTP-binding proteins [BR:eai04031]     106828357 (RAB1A) Membrane trafficking [BR:eai04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     106828357 (RAB1A)  Autophagy   Other autophagy associated proteins     106828357 (RAB1A) Exosome [BR:eai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106828357 (RAB1A)   Exosomal proteins of other body fluids (saliva and urine)    106828357 (RAB1A)   Exosomal proteins of colorectal cancer cells    106828357 (RAB1A) GTP-binding proteins [BR:eai04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     106828357 (RAB1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA ABC_tran AAA_7 PduV-EutP AAA_16 LANC_like AAA_29 Septin AAA_22 AAA_5 CRAL_TRIO_2 Motif Other DBs NCBI-GeneID:  106828357 NCBI-ProteinID:  XP_044628523 LinkDB All DBs Position 6:complement(56038315..56067561) Genome browser AA seq 205 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA TAGGAEKSNVKIQSTPVKQSGGGCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactct ggggttggaaagtcttgcctccttcttaggtttgcagatgatacatatacagaaagctac atcagcacaattggtgtggatttcaaaataagaactatagagttagatgggaaaacaatc aagcttcagatatgggacacagcaggccaagaaagatttcgaacaatcacctccagttat tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat aatgttaaacagtggctgcaggaaatagatcgttatgccagtgaaaacgtcaacaagttg ttggtagggaacaaatgtgatctgaccacaaagaaggtggtagactacacgacagcaaag gaatttgctgattcccttggaattccatttttggaaaccagtgctaagaatgcaacgaat gtagaacagtctttcatgaccatggcagctgagattaaaaagcgaatgggtcctggagca acagctggcggtgcagagaagtccaacgttaaaattcagagcactccggtcaagcagtca ggtggaggttgctgctaa

DBGET integrated database retrieval system