Equus asinus (ass): 106831472 Help Entry 106831472         CDS       T04645                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism eai  Equus asinus (ass) Pathway eai04068   FoxO signaling pathway eai04136   Autophagy - other eai04140   Autophagy - animal eai04621   NOD-like receptor signaling pathway eai04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     106831472 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106831472 (ATG12)    04136 Autophagy - other     106831472 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106831472 (ATG12)    04622 RIG-I-like receptor signaling pathway     106831472 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eai04131]     106831472 (ATG12)    04121 Ubiquitin system [BR:eai04121]     106831472 (ATG12)    03029 Mitochondrial biogenesis [BR:eai03029]     106831472 (ATG12) Membrane trafficking [BR:eai04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     106831472 (ATG12) Ubiquitin system [BR:eai04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    106831472 (ATG12) Mitochondrial biogenesis [BR:eai03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     106831472 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  106831472 NCBI-ProteinID:  XP_014697196 UniProt:  A0A9L0JE28 LinkDB All DBs Position 11:complement(83125649..83139460) Genome browser AA seq 140 aa AA seqDB search MAEEPESALQLSPSTAADGEGPTEVSPETATPEPPSSAAVSPGTEEPAGDTKKKIDILLK AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY ECFGSDGKLVLHYCKSQAWG NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctgaggagccggagtcagcgctgcagctttctccctcgactgcggctgatggcgaa ggacctacggaggtttccccagaaacggccactccggagcccccctcttccgctgcagtc tcgccgggaacagaggagcctgccggcgacaccaaaaaaaaaattgacatcctgctaaag gctgtgggagacacccctataatgaaaacaaagaagtgggctgtagagcgaacccgaacc atccaaggactcattgacttcatcaaaaagttcctaaaacttgtggcctcagaacagttg tttatttatgtgaatcagtcctttgccccctccccagaccaggaagttggaaccctctat gagtgttttggcagtgatggtaaactggtcctgcattactgcaaatctcaggcatgggga tga

DBGET integrated database retrieval system