Equus asinus (ass): 106831668 Help Entry 106831668         CDS       T04645                                  Symbol P2RY2 Name (RefSeq) P2Y purinoceptor 2   KO K04269   P2Y purinoceptor 2 Organism eai  Equus asinus (ass) Pathway eai04080   Neuroactive ligand-receptor interaction eai04082   Neuroactive ligand signaling eai04148   Efferocytosis eai04750   Inflammatory mediator regulation of TRP channels Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     106831668 (P2RY2)    04082 Neuroactive ligand signaling     106831668 (P2RY2)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     106831668 (P2RY2)  09150 Organismal Systems   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     106831668 (P2RY2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04030 G protein-coupled receptors [BR:eai04030]     106831668 (P2RY2) G protein-coupled receptors [BR:eai04030]  Rhodopsin family   Base and nucleoside    Purine / pyrimidine     106831668 (P2RY2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  106831668 NCBI-ProteinID:  XP_044609006 LinkDB All DBs Position 20:complement(71579938..71594870) Genome browser AA seq 122 aa AA seqDB search MPRAMATGLGLWNGTKNGTWDGDELGYKCRFNENFKYVLLPVSYGVVCVLGLCLNAVALY IFLCRLKTWNASTTYMFHRRSNSATCSLLPCTCLSGGCYCGQPLALGQAHGGARPSLPLP YL NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgccccgggcgatggccacaggcctgggcctctggaatggcaccaagaatggcacctgg gatggggatgagctgggctacaagtgccgcttcaacgagaacttcaagtacgtgctgctg cccgtgtcctacggcgtggtgtgcgtgctggggctctgtctgaacgccgtggcactctac atcttcctgtgccgcctcaagacctggaacgcctccaccacgtacatgttccaccgccga tctaactcggccacctgtagcctcttgccctgtacgtgcttgtctggtgggtgctactgc gggcagccgctggccctgggccaggctcacggcggtgcgcgcccctctctaccacttccc tacctgtaa

DBGET integrated database retrieval system