Equus asinus (ass): 106831752 Help Entry 106831752         CDS       T04645                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism eai  Equus asinus (ass) Pathway eai04014   Ras signaling pathway eai04137   Mitophagy - animal eai04144   Endocytosis eai04145   Phagosome eai04148   Efferocytosis eai04962   Vasopressin-regulated water reabsorption eai05014   Amyotrophic lateral sclerosis eai05022   Pathways of neurodegeneration - multiple diseases eai05132   Salmonella infection eai05146   Amoebiasis eai05152   Tuberculosis Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     106831752 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106831752 (RAB5A)    04145 Phagosome     106831752 (RAB5A)    04137 Mitophagy - animal     106831752 (RAB5A)    04148 Efferocytosis     106831752 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     106831752 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106831752 (RAB5A)    05152 Tuberculosis     106831752 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     106831752 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106831752 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     106831752 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eai04131]     106831752 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eai04147]     106831752 (RAB5A)    04031 GTP-binding proteins [BR:eai04031]     106831752 (RAB5A) Membrane trafficking [BR:eai04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     106831752 (RAB5A)  Endosome - Lysosome transport     106831752 (RAB5A) Exosome [BR:eai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106831752 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    106831752 (RAB5A)   Exosomal proteins of colorectal cancer cells    106831752 (RAB5A)   Exosomal proteins of bladder cancer cells    106831752 (RAB5A) GTP-binding proteins [BR:eai04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     106831752 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  106831752 NCBI-ProteinID:  XP_014697636 UniProt:  A0A8C4LDA5 LinkDB All DBs Position 21:34593016..34622218 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactgggaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaagggccaatttcatgaatttcaagagagtaccatcggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagctgccatagttgtttat gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa agagctgtcgatttccaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtgaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatcccggagcaaattctgccagaggaagaggagtagac cttactgaacccacacagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system