Equus asinus (ass): 106831788 Help Entry 106831788         CDS       T04645                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism eai  Equus asinus (ass) Pathway eai04010   MAPK signaling pathway eai04020   Calcium signaling pathway eai04022   cGMP-PKG signaling pathway eai04114   Oocyte meiosis eai04218   Cellular senescence eai04310   Wnt signaling pathway eai04360   Axon guidance eai04370   VEGF signaling pathway eai04380   Osteoclast differentiation eai04625   C-type lectin receptor signaling pathway eai04650   Natural killer cell mediated cytotoxicity eai04658   Th1 and Th2 cell differentiation eai04659   Th17 cell differentiation eai04660   T cell receptor signaling pathway eai04662   B cell receptor signaling pathway eai04720   Long-term potentiation eai04724   Glutamatergic synapse eai04921   Oxytocin signaling pathway eai04922   Glucagon signaling pathway eai04924   Renin secretion eai05010   Alzheimer disease eai05014   Amyotrophic lateral sclerosis eai05020   Prion disease eai05022   Pathways of neurodegeneration - multiple diseases eai05031   Amphetamine addiction eai05152   Tuberculosis eai05163   Human cytomegalovirus infection eai05166   Human T-cell leukemia virus 1 infection eai05167   Kaposi sarcoma-associated herpesvirus infection eai05170   Human immunodeficiency virus 1 infection eai05235   PD-L1 expression and PD-1 checkpoint pathway in cancer eai05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106831788 (PPP3R2)    04310 Wnt signaling pathway     106831788 (PPP3R2)    04370 VEGF signaling pathway     106831788 (PPP3R2)    04020 Calcium signaling pathway     106831788 (PPP3R2)    04022 cGMP-PKG signaling pathway     106831788 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     106831788 (PPP3R2)    04218 Cellular senescence     106831788 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106831788 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     106831788 (PPP3R2)    04660 T cell receptor signaling pathway     106831788 (PPP3R2)    04658 Th1 and Th2 cell differentiation     106831788 (PPP3R2)    04659 Th17 cell differentiation     106831788 (PPP3R2)    04662 B cell receptor signaling pathway     106831788 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     106831788 (PPP3R2)    04921 Oxytocin signaling pathway     106831788 (PPP3R2)    04924 Renin secretion     106831788 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     106831788 (PPP3R2)    04720 Long-term potentiation     106831788 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     106831788 (PPP3R2)    04380 Osteoclast differentiation     106831788 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     106831788 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     106831788 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     106831788 (PPP3R2)    05163 Human cytomegalovirus infection     106831788 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     106831788 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     106831788 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     106831788 (PPP3R2)    05014 Amyotrophic lateral sclerosis     106831788 (PPP3R2)    05020 Prion disease     106831788 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     106831788 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     106831788 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106831788 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:eai01009]     106831788 (PPP3R2) Protein phosphatases and associated proteins [BR:eai01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      106831788 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Pam3_gp18 YtfJ_HI0045 RST Motif Other DBs NCBI-GeneID:  106831788 NCBI-ProteinID:  XP_014697682 UniProt:  A0A9L0IAV5 LinkDB All DBs Position 10:38762348..38763366 Genome browser AA seq 171 aa AA seqDB search MGNEASYPEEMCSQFDHDEIKRLSKRFKKLDLDNSGSLSVDEFLSLPQLQRNPLAKRVID VFDTDGNGVVDFKEFIVGTSQFSVKGSEEQKLRFAFSIYDMDKDGYISNGELFQVLKLMV GDDTLTDWELQEVVDKTIICLDTDGDGKISYEEFSAVVRGLEIHKNLVVAV NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggccagttacccggaggaaatgtgctcccagtttgaccatgatgaaatt aaaaggctgagcaagaggtttaagaagctggacttggacaattcgggctctctgagcgtg gatgagttcctgtcgctgccccagctgcagcggaatccgttggcgaagagagtgatcgac gtcttcgacaccgacggcaatggcgtagtggacttcaaggaattcatcgtggggacctcc cagttcagtgtcaagggcagcgaggagcagaagctaaggtttgctttcagcatctacgac atggacaaagacggctacatttccaacggagagctcttccaggtgctgaagttgatggtg ggggacgacaccctgacagactgggagttacaggaggtcgtcgacaaaaccatcatctgc ctggatacagacggcgatgggaaaatatcctacgaggaattcagcgctgtggtccgaggc ctggagatccacaagaacttggtggtggctgtgtga

DBGET integrated database retrieval system