Equus asinus (ass): 106832587 Help Entry 106832587         CDS       T04645                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism eai  Equus asinus (ass) Pathway eai04024   cAMP signaling pathway eai04080   Neuroactive ligand-receptor interaction eai04081   Hormone signaling eai04935   Growth hormone synthesis, secretion and action eai04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     106832587 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     106832587 (SST)    04081 Hormone signaling     106832587 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     106832587 (SST)   09154 Digestive system    04971 Gastric acid secretion     106832587 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eai04052]     106832587 (SST) Cytokines and neuropeptides [BR:eai04052]  Neuropeptides   GPCR binding    106832587 (SST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  106832587 NCBI-ProteinID:  XP_014698912 UniProt:  A0A9L0J6J5 LinkDB All DBs Position 5:complement(77669874..77671357) Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVMALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctccatcgtcatggctctgggc ggtgtcaccggcgcgccctcggatccccgactccgtcagtttctgcagaagtccctggct gctgccgcggggaagcaggaactggccaagtacttcttggcagagctactgtctgaaccc aaccagacagagaacgatgccctggaacctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggagctgcagagatctgctaactcaaacccggccatggctccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system