Equus asinus (ass): 106833560 Help Entry 106833560         CDS       T04645                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism eai  Equus asinus (ass) Pathway eai04360   Axon guidance eai04666   Fc gamma R-mediated phagocytosis eai04810   Regulation of actin cytoskeleton eai05133   Pertussis eai05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:eai00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     106833560 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     106833560 (CFL1)   09158 Development and regeneration    04360 Axon guidance     106833560 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     106833560 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     106833560 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eai04131]     106833560 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:eai04812]     106833560 (CFL1)    04147 Exosome [BR:eai04147]     106833560 (CFL1) Membrane trafficking [BR:eai04131]  Others   Actin-binding proteins    Others     106833560 (CFL1) Cytoskeleton proteins [BR:eai04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      106833560 (CFL1) Exosome [BR:eai04147]  Exosomal proteins   Proteins found in most exosomes    106833560 (CFL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  106833560 NCBI-ProteinID:  XP_014700305 LinkDB All DBs Position 29:3349568..3353666 Genome browser AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctctgatggcgtcatcaaagtgttcaatgacatgaaggtg cgtaagtcgtcaacaccagaggaggtaaagaagcgcaagaaggcagtgctcttctgcctg agcgaggacaagaagaacatcatcctcgaggagggcaaggagatcctggtaggtgatgtg ggccagaccgtagacgacccctacgccacctttgtcaagatgctgccagacaaggactgc cgctatgccctctatgacgcaacctacgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggcccctgagtctgcaccccttaagagcaaaatgatctacgccagctcc aaggacgccatcaagaagaagctgacggggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgttgcactctggcagagaagctggggggcagcgccgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system