Equus asinus (ass): 106833712 Help Entry 106833712         CDS       T04645                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism eai  Equus asinus (ass) Pathway eai01521   EGFR tyrosine kinase inhibitor resistance eai01524   Platinum drug resistance eai04014   Ras signaling pathway eai04064   NF-kappa B signaling pathway eai04115   p53 signaling pathway eai04137   Mitophagy - animal eai04140   Autophagy - animal eai04151   PI3K-Akt signaling pathway eai04210   Apoptosis eai04215   Apoptosis - multiple species eai04621   NOD-like receptor signaling pathway eai04630   JAK-STAT signaling pathway eai05012   Parkinson disease eai05014   Amyotrophic lateral sclerosis eai05022   Pathways of neurodegeneration - multiple diseases eai05145   Toxoplasmosis eai05162   Measles eai05166   Human T-cell leukemia virus 1 infection eai05168   Herpes simplex virus 1 infection eai05170   Human immunodeficiency virus 1 infection eai05200   Pathways in cancer eai05202   Transcriptional misregulation in cancer eai05212   Pancreatic cancer eai05220   Chronic myeloid leukemia eai05222   Small cell lung cancer eai05225   Hepatocellular carcinoma eai05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     106833712 (BCL2L1)    04630 JAK-STAT signaling pathway     106833712 (BCL2L1)    04064 NF-kappa B signaling pathway     106833712 (BCL2L1)    04151 PI3K-Akt signaling pathway     106833712 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106833712 (BCL2L1)    04137 Mitophagy - animal     106833712 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     106833712 (BCL2L1)    04215 Apoptosis - multiple species     106833712 (BCL2L1)    04115 p53 signaling pathway     106833712 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106833712 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106833712 (BCL2L1)    05202 Transcriptional misregulation in cancer     106833712 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     106833712 (BCL2L1)    05225 Hepatocellular carcinoma     106833712 (BCL2L1)    05220 Chronic myeloid leukemia     106833712 (BCL2L1)    05222 Small cell lung cancer     106833712 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     106833712 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     106833712 (BCL2L1)    05162 Measles     106833712 (BCL2L1)    05168 Herpes simplex virus 1 infection     106833712 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     106833712 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     106833712 (BCL2L1)    05014 Amyotrophic lateral sclerosis     106833712 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     106833712 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106833712 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     106833712 (BCL2L1)    01524 Platinum drug resistance     106833712 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:eai01009]     106833712 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eai03036]     106833712 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:eai02000]     106833712 (BCL2L1) Protein phosphatases and associated proteins [BR:eai01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      106833712 (BCL2L1) Chromosome and associated proteins [BR:eai03036]  Eukaryotic type   Centrosome formation proteins    Other centriole associated proteins     106833712 (BCL2L1) Transporters [BR:eai02000]  Other transporters   Pores ion channels [TC:1]    106833712 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  106833712 NCBI-ProteinID:  XP_014700525 UniProt:  A0A8C4L2X1 LinkDB All DBs Position 15:complement(22843740..22888644) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPTGNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacaactggagtcagtttagtgacgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccccacggggaatggagccactggccacagcagcagcttggatgcccgggaagtg atccccatggcagcagtgaagcaagcgctgagggaggcaggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacctggatggccacttacctgaatgaccacctagagcct tggatccaagagaacggcggctgggacacctttgtggaactctacgggaacaacgcggca gccgaaagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcgctcttcagtcggaagtga

DBGET integrated database retrieval system