Equus asinus (ass): 106833785 Help Entry 106833785         CDS       T04645                                  Symbol CALML5 Name (RefSeq) calmodulin-like protein 5   KO K02183   calmodulin Organism eai  Equus asinus (ass) Pathway eai04014   Ras signaling pathway eai04015   Rap1 signaling pathway eai04020   Calcium signaling pathway eai04022   cGMP-PKG signaling pathway eai04024   cAMP signaling pathway eai04070   Phosphatidylinositol signaling system eai04114   Oocyte meiosis eai04218   Cellular senescence eai04261   Adrenergic signaling in cardiomyocytes eai04270   Vascular smooth muscle contraction eai04371   Apelin signaling pathway eai04625   C-type lectin receptor signaling pathway eai04713   Circadian entrainment eai04720   Long-term potentiation eai04722   Neurotrophin signaling pathway eai04728   Dopaminergic synapse eai04740   Olfactory transduction eai04744   Phototransduction eai04750   Inflammatory mediator regulation of TRP channels eai04910   Insulin signaling pathway eai04912   GnRH signaling pathway eai04915   Estrogen signaling pathway eai04916   Melanogenesis eai04921   Oxytocin signaling pathway eai04922   Glucagon signaling pathway eai04924   Renin secretion eai04925   Aldosterone synthesis and secretion eai04970   Salivary secretion eai04971   Gastric acid secretion eai05010   Alzheimer disease eai05012   Parkinson disease eai05022   Pathways of neurodegeneration - multiple diseases eai05031   Amphetamine addiction eai05034   Alcoholism eai05133   Pertussis eai05152   Tuberculosis eai05163   Human cytomegalovirus infection eai05167   Kaposi sarcoma-associated herpesvirus infection eai05170   Human immunodeficiency virus 1 infection eai05200   Pathways in cancer eai05214   Glioma eai05417   Lipid and atherosclerosis eai05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     106833785 (CALML5)    04015 Rap1 signaling pathway     106833785 (CALML5)    04371 Apelin signaling pathway     106833785 (CALML5)    04020 Calcium signaling pathway     106833785 (CALML5)    04070 Phosphatidylinositol signaling system     106833785 (CALML5)    04024 cAMP signaling pathway     106833785 (CALML5)    04022 cGMP-PKG signaling pathway     106833785 (CALML5)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     106833785 (CALML5)    04218 Cellular senescence     106833785 (CALML5)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106833785 (CALML5)   09152 Endocrine system    04910 Insulin signaling pathway     106833785 (CALML5)    04922 Glucagon signaling pathway     106833785 (CALML5)    04912 GnRH signaling pathway     106833785 (CALML5)    04915 Estrogen signaling pathway     106833785 (CALML5)    04921 Oxytocin signaling pathway     106833785 (CALML5)    04916 Melanogenesis     106833785 (CALML5)    04924 Renin secretion     106833785 (CALML5)    04925 Aldosterone synthesis and secretion     106833785 (CALML5)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     106833785 (CALML5)    04270 Vascular smooth muscle contraction     106833785 (CALML5)   09154 Digestive system    04970 Salivary secretion     106833785 (CALML5)    04971 Gastric acid secretion     106833785 (CALML5)   09156 Nervous system    04728 Dopaminergic synapse     106833785 (CALML5)    04720 Long-term potentiation     106833785 (CALML5)    04722 Neurotrophin signaling pathway     106833785 (CALML5)   09157 Sensory system    04744 Phototransduction     106833785 (CALML5)    04740 Olfactory transduction     106833785 (CALML5)    04750 Inflammatory mediator regulation of TRP channels     106833785 (CALML5)   09159 Environmental adaptation    04713 Circadian entrainment     106833785 (CALML5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106833785 (CALML5)   09162 Cancer: specific types    05214 Glioma     106833785 (CALML5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     106833785 (CALML5)    05163 Human cytomegalovirus infection     106833785 (CALML5)    05167 Kaposi sarcoma-associated herpesvirus infection     106833785 (CALML5)   09171 Infectious disease: bacterial    05133 Pertussis     106833785 (CALML5)    05152 Tuberculosis     106833785 (CALML5)   09164 Neurodegenerative disease    05010 Alzheimer disease     106833785 (CALML5)    05012 Parkinson disease     106833785 (CALML5)    05022 Pathways of neurodegeneration - multiple diseases     106833785 (CALML5)   09165 Substance dependence    05031 Amphetamine addiction     106833785 (CALML5)    05034 Alcoholism     106833785 (CALML5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106833785 (CALML5)    05418 Fluid shear stress and atherosclerosis     106833785 (CALML5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:eai01009]     106833785 (CALML5)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eai04131]     106833785 (CALML5)    03036 Chromosome and associated proteins [BR:eai03036]     106833785 (CALML5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eai04147]     106833785 (CALML5) Protein phosphatases and associated proteins [BR:eai01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      106833785 (CALML5) Membrane trafficking [BR:eai04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     106833785 (CALML5) Chromosome and associated proteins [BR:eai03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      106833785 (CALML5) Exosome [BR:eai04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106833785 (CALML5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EH SPARC_Ca_bdg Dockerin_1 DUF5580_M EF_EFCAB10_C TerB SurA_N_2 SurA_N_3 RNase_H Motif Other DBs NCBI-GeneID:  106833785 NCBI-ProteinID:  XP_014700605 UniProt:  A0A9L0IAH9 LinkDB All DBs Position 29:24228642..24229543 Genome browser AA seq 149 aa AA seqDB search MAEKLSEEQVAEFKEAFSSVDKNGDGTINTQELGAVMQALGHSLSEAELNELITRVDSDG DGVINFQEFLAEMVKRRKAWGSEQDLQGVFRAFDLDGDGHINVDELKQAIGKLGDEVSEE ALEVMIRQADLDQDGKVSYEEFVRILTQK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgagaagctgtctgaagagcaggtggccgagttcaaggaggccttctccagtgtt gacaagaatggggatggcaccatcaacacccaggagctgggcgccgtgatgcaggccttg ggccacagtctgtcggaggccgagttgaatgagctcatcaccagggtggactctgatggc gatggcgtcatcaacttccaagagttcctggcggagatggtcaagaggaggaaggcctgg ggcagtgaacaggacctgcagggggtcttccgtgcctttgacctggacggtgacggccac atcaacgtggatgagctcaagcaggccataggcaagctaggggatgaggtttccgaggag gcgctggaagtcatgatccgccaggctgacttggaccaggacgggaaggtgagctacgag gagttcgtgcgcatcctcacccagaagtga

DBGET integrated database retrieval system