Equus asinus (ass): 106834413 Help Entry 106834413         CDS       T04645                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism eai  Equus asinus (ass) Brite KEGG Orthology (KO) [BR:eai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:eai03041]     106834413 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eai04052]     106834413 (UBL5) Spliceosome [BR:eai03041]  Complex B   Other components    Complex B specific factors     106834413 (UBL5) Cytokines and neuropeptides [BR:eai04052]  Neuropeptides   Unclassified    106834413 (UBL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  106834413 NCBI-ProteinID:  XP_014701509 LinkDB All DBs Position 20:8548732..8550331 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctgggcaagaaggtccgcgttaagtgcaacacg gatgacaccatcggggaccttaagaagctgatcgcagcccaaacgggcacccgttggaac aagatcgtccttaagaagtggtacacgatttttaaggaccacgtgtccctgggggactat gaaatccacgatggcatgaacctggagctttattaccagtag

DBGET integrated database retrieval system