Equus asinus (ass): 106835623 Help Entry 106835623         CDS       T04645                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism eai  Equus asinus (ass) Pathway eai04810   Regulation of actin cytoskeleton eai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eai00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     106835623 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106835623 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  106835623 NCBI-ProteinID:  XP_014703637 UniProt:  A0A9L0J8Z5 LinkDB All DBs Position 21:90151090..90159584 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggacaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcggactttctcaactctttcgat atgtcttgtcgttcaagactcgcaacactaaacgagaaattgacagcccttgaacggaga atagagtacattgaagcccgggtgacaaaaggtgagacgctcacctag

DBGET integrated database retrieval system