Equus asinus (ass): 106835678 Help Entry 106835678         CDS       T04645                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism eai  Equus asinus (ass) Pathway eai01521   EGFR tyrosine kinase inhibitor resistance eai01522   Endocrine resistance eai04010   MAPK signaling pathway eai04012   ErbB signaling pathway eai04014   Ras signaling pathway eai04015   Rap1 signaling pathway eai04062   Chemokine signaling pathway eai04068   FoxO signaling pathway eai04071   Sphingolipid signaling pathway eai04072   Phospholipase D signaling pathway eai04137   Mitophagy - animal eai04140   Autophagy - animal eai04150   mTOR signaling pathway eai04151   PI3K-Akt signaling pathway eai04210   Apoptosis eai04211   Longevity regulating pathway eai04213   Longevity regulating pathway - multiple species eai04218   Cellular senescence eai04360   Axon guidance eai04370   VEGF signaling pathway eai04371   Apelin signaling pathway eai04540   Gap junction eai04550   Signaling pathways regulating pluripotency of stem cells eai04625   C-type lectin receptor signaling pathway eai04650   Natural killer cell mediated cytotoxicity eai04660   T cell receptor signaling pathway eai04662   B cell receptor signaling pathway eai04664   Fc epsilon RI signaling pathway eai04714   Thermogenesis eai04720   Long-term potentiation eai04722   Neurotrophin signaling pathway eai04725   Cholinergic synapse eai04726   Serotonergic synapse eai04730   Long-term depression eai04810   Regulation of actin cytoskeleton eai04910   Insulin signaling pathway eai04912   GnRH signaling pathway eai04915   Estrogen signaling pathway eai04916   Melanogenesis eai04917   Prolactin signaling pathway eai04919   Thyroid hormone signaling pathway eai04921   Oxytocin signaling pathway eai04926   Relaxin signaling pathway eai04929   GnRH secretion eai04933   AGE-RAGE signaling pathway in diabetic complications eai04935   Growth hormone synthesis, secretion and action eai05010   Alzheimer disease eai05022   Pathways of neurodegeneration - multiple diseases eai05034   Alcoholism eai05160   Hepatitis C eai05161   Hepatitis B eai05163   Human cytomegalovirus infection eai05165   Human papillomavirus infection eai05166   Human T-cell leukemia virus 1 infection eai05167   Kaposi sarcoma-associated herpesvirus infection eai05170   Human immunodeficiency virus 1 infection eai05200   Pathways in cancer eai05203   Viral carcinogenesis eai05205   Proteoglycans in cancer eai05206   MicroRNAs in cancer eai05207   Chemical carcinogenesis - receptor activation eai05208   Chemical carcinogenesis - reactive oxygen species eai05210   Colorectal cancer eai05211   Renal cell carcinoma eai05213   Endometrial cancer eai05214   Glioma eai05215   Prostate cancer eai05216   Thyroid cancer eai05218   Melanoma eai05219   Bladder cancer eai05220   Chronic myeloid leukemia eai05221   Acute myeloid leukemia eai05223   Non-small cell lung cancer eai05224   Breast cancer eai05225   Hepatocellular carcinoma eai05226   Gastric cancer eai05230   Central carbon metabolism in cancer eai05231   Choline metabolism in cancer eai05235   PD-L1 expression and PD-1 checkpoint pathway in cancer eai05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106835678 (NRAS)    04012 ErbB signaling pathway     106835678 (NRAS)    04014 Ras signaling pathway     106835678 (NRAS)    04015 Rap1 signaling pathway     106835678 (NRAS)    04370 VEGF signaling pathway     106835678 (NRAS)    04371 Apelin signaling pathway     106835678 (NRAS)    04068 FoxO signaling pathway     106835678 (NRAS)    04072 Phospholipase D signaling pathway     106835678 (NRAS)    04071 Sphingolipid signaling pathway     106835678 (NRAS)    04151 PI3K-Akt signaling pathway     106835678 (NRAS)    04150 mTOR signaling pathway     106835678 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106835678 (NRAS)    04137 Mitophagy - animal     106835678 (NRAS)   09143 Cell growth and death    04210 Apoptosis     106835678 (NRAS)    04218 Cellular senescence     106835678 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     106835678 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     106835678 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     106835678 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106835678 (NRAS)    04650 Natural killer cell mediated cytotoxicity     106835678 (NRAS)    04660 T cell receptor signaling pathway     106835678 (NRAS)    04662 B cell receptor signaling pathway     106835678 (NRAS)    04664 Fc epsilon RI signaling pathway     106835678 (NRAS)    04062 Chemokine signaling pathway     106835678 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     106835678 (NRAS)    04929 GnRH secretion     106835678 (NRAS)    04912 GnRH signaling pathway     106835678 (NRAS)    04915 Estrogen signaling pathway     106835678 (NRAS)    04917 Prolactin signaling pathway     106835678 (NRAS)    04921 Oxytocin signaling pathway     106835678 (NRAS)    04926 Relaxin signaling pathway     106835678 (NRAS)    04935 Growth hormone synthesis, secretion and action     106835678 (NRAS)    04919 Thyroid hormone signaling pathway     106835678 (NRAS)    04916 Melanogenesis     106835678 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     106835678 (NRAS)    04726 Serotonergic synapse     106835678 (NRAS)    04720 Long-term potentiation     106835678 (NRAS)    04730 Long-term depression     106835678 (NRAS)    04722 Neurotrophin signaling pathway     106835678 (NRAS)   09158 Development and regeneration    04360 Axon guidance     106835678 (NRAS)   09149 Aging    04211 Longevity regulating pathway     106835678 (NRAS)    04213 Longevity regulating pathway - multiple species     106835678 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     106835678 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106835678 (NRAS)    05206 MicroRNAs in cancer     106835678 (NRAS)    05205 Proteoglycans in cancer     106835678 (NRAS)    05207 Chemical carcinogenesis - receptor activation     106835678 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     106835678 (NRAS)    05203 Viral carcinogenesis     106835678 (NRAS)    05230 Central carbon metabolism in cancer     106835678 (NRAS)    05231 Choline metabolism in cancer     106835678 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     106835678 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     106835678 (NRAS)    05225 Hepatocellular carcinoma     106835678 (NRAS)    05226 Gastric cancer     106835678 (NRAS)    05214 Glioma     106835678 (NRAS)    05216 Thyroid cancer     106835678 (NRAS)    05221 Acute myeloid leukemia     106835678 (NRAS)    05220 Chronic myeloid leukemia     106835678 (NRAS)    05218 Melanoma     106835678 (NRAS)    05211 Renal cell carcinoma     106835678 (NRAS)    05219 Bladder cancer     106835678 (NRAS)    05215 Prostate cancer     106835678 (NRAS)    05213 Endometrial cancer     106835678 (NRAS)    05224 Breast cancer     106835678 (NRAS)    05223 Non-small cell lung cancer     106835678 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     106835678 (NRAS)    05170 Human immunodeficiency virus 1 infection     106835678 (NRAS)    05161 Hepatitis B     106835678 (NRAS)    05160 Hepatitis C     106835678 (NRAS)    05163 Human cytomegalovirus infection     106835678 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     106835678 (NRAS)    05165 Human papillomavirus infection     106835678 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     106835678 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     106835678 (NRAS)   09165 Substance dependence    05034 Alcoholism     106835678 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106835678 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     106835678 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     106835678 (NRAS)    01522 Endocrine resistance     106835678 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eai04131]     106835678 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eai04147]     106835678 (NRAS)    04031 GTP-binding proteins [BR:eai04031]     106835678 (NRAS) Membrane trafficking [BR:eai04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     106835678 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     106835678 (NRAS) Exosome [BR:eai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106835678 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    106835678 (NRAS)   Exosomal proteins of breast cancer cells    106835678 (NRAS)   Exosomal proteins of colorectal cancer cells    106835678 (NRAS) GTP-binding proteins [BR:eai04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106835678 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  106835678 NCBI-ProteinID:  XP_044605475 UniProt:  A0A8C4LG40 LinkDB All DBs Position 16:4885401..4895417 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttggaaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgagtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggctaagagttatgggattccg ttcatcgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggtg agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgcatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system