Equus asinus (ass): 106841422 Help Entry 106841422         CDS       T04645                                  Symbol DEFB1 Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism eai  Equus asinus (ass) Pathway eai02010   ABC transporters eai05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     106841422 (DEFB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     106841422 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:eai02000]     106841422 (DEFB1)    03037 Cilium and associated proteins [BR:eai03037]     106841422 (DEFB1) Transporters [BR:eai02000]  Other transporters   Pores ion channels [TC:1]    106841422 (DEFB1) Cilium and associated proteins [BR:eai03037]  Motile cilia and associated proteins   Sperm associated proteins    106841422 (DEFB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Defensin_beta Motif Other DBs NCBI-GeneID:  106841422 NCBI-ProteinID:  XP_014712926 UniProt:  A0A9L0J9P5 LinkDB All DBs Position 27:complement(6231493..6245530) Genome browser AA seq 68 aa AA seqDB search MRAPYFLLLTLCLLCCQMSSGVGYLTGLGHRSDHYICARSGGTCHFSSCPLFTKIEGTCY GGKAKCCL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagggcaccctactttctgctgctgaccctctgcctcctctgctgccagatgtcctca ggtgtcggctatctcacgggtctcggccacaggtctgaccattacatctgtgccaggagt ggcggcacctgtcacttctcctcttgcccgctcttcaccaagattgagggcacttgttac ggcgggaaggccaagtgctgcctctga

DBGET integrated database retrieval system