Equus asinus (ass): 106843180 Help Entry 106843180         CDS       T04645                                  Symbol CCK Name (RefSeq) cholecystokinin   KO K05226   cholecystokinin Organism eai  Equus asinus (ass) Pathway eai04080   Neuroactive ligand-receptor interaction eai04081   Hormone signaling eai04911   Insulin secretion eai04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     106843180 (CCK)    04081 Hormone signaling     106843180 (CCK)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     106843180 (CCK)   09154 Digestive system    04972 Pancreatic secretion     106843180 (CCK)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eai04052]     106843180 (CCK) Cytokines and neuropeptides [BR:eai04052]  Neuropeptides   GPCR binding    106843180 (CCK) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  106843180 NCBI-ProteinID:  XP_014715610 UniProt:  A0A9L0IBB0 LinkDB All DBs Position 21:complement(53021485..53027206) Genome browser AA seq 114 aa AA seqDB search MNSGACLCVLMAVLAAGALAQPVPPEDAAGPGAQQEEAPRRQLRAVQRVDSEPRAHLGAL LARYIQQTRKAPSGRMSLVKNLQGLDPSHRISDRDYMGWMDFGRRSAEEYEYPF NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgaacagcggcgcgtgcctgtgcgtgctgatggcggtgctggcggcgggcgccctggcg cagcccgtgcctccggaggacgctgcgggccccggggcacagcaggaggaggcgccccgg aggcagctgagggcggtgcagagggtggacagcgagccccgcgcacacctgggcgcgctg ctggccagatacatccagcagacccggaaagctccttctggccgaatgtccctcgtgaag aacctgcagggcctggaccccagccacaggataagtgaccgggactacatgggctggatg gactttggtcggcgcagcgccgaggagtatgaataccccttctag

DBGET integrated database retrieval system