Equus asinus (ass): 106844660 Help Entry 106844660         CDS       T04645                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism eai  Equus asinus (ass) Pathway eai04060   Cytokine-cytokine receptor interaction eai04061   Viral protein interaction with cytokine and cytokine receptor eai04062   Chemokine signaling pathway eai04620   Toll-like receptor signaling pathway eai04621   NOD-like receptor signaling pathway eai04623   Cytosolic DNA-sensing pathway eai04668   TNF signaling pathway eai05020   Prion disease eai05142   Chagas disease eai05163   Human cytomegalovirus infection eai05164   Influenza A eai05168   Herpes simplex virus 1 infection eai05323   Rheumatoid arthritis eai05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     106844660 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106844660 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     106844660 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106844660 (CCL5)    04621 NOD-like receptor signaling pathway     106844660 (CCL5)    04623 Cytosolic DNA-sensing pathway     106844660 (CCL5)    04062 Chemokine signaling pathway     106844660 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     106844660 (CCL5)    05168 Herpes simplex virus 1 infection     106844660 (CCL5)    05163 Human cytomegalovirus infection     106844660 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     106844660 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     106844660 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     106844660 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106844660 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eai04052]     106844660 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:eai00536]     106844660 (CCL5) Cytokines and neuropeptides [BR:eai04052]  Cytokines   Chemokines    106844660 (CCL5) Glycosaminoglycan binding proteins [BR:eai00536]  Heparan sulfate / Heparin   Chemokines    106844660 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  106844660 NCBI-ProteinID:  XP_014717726 UniProt:  A0A9L0J4M4 LinkDB All DBs Position 13:complement(27296548..27302687) Genome browser AA seq 91 aa AA seqDB search MKVFAAALAVILATAAFCTPASASPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSMP AVVFVTRKKRQVCANPEKKWVREYINTLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcttcgcagctgccctggcggtcatcctcgccactgccgccttctgcactcct gcatctgcctccccatatgcctcggacaccacgccctgctgctttgcctacatctcccgc ccactgccccgcgcccacatccaagagtatttctacaccagcagcaagtgctctatgcca gcagtcgtctttgtcacccgaaagaagcgccaggtgtgtgccaatccagagaagaaatgg gtgcgagagtacatcaacactttggagatgagctag

DBGET integrated database retrieval system