Equus asinus (ass): 106844836 Help Entry 106844836         CDS       T04645                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism eai  Equus asinus (ass) Pathway eai04022   cGMP-PKG signaling pathway eai04081   Hormone signaling eai04270   Vascular smooth muscle contraction eai05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     106844836 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     106844836 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     106844836 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     106844836 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eai04052]     106844836 (NPPC) Cytokines and neuropeptides [BR:eai04052]  Neuropeptides   Unclassified    106844836 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  106844836 NCBI-ProteinID:  XP_014718006 UniProt:  A0A8C4LRI4 LinkDB All DBs Position 19:9293554..9298475 Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRGAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctgctctcgctccggccc tctgaagccaagcccggggcgccgccgaaggtcccgcgaactccgccgggggaggagctg gccgagccccaggctgcgggcggtggacagaagaagggcgacaagacccctggaggcggc ggcgccaacctcaagggcgaccggtctagactgctccgggacctgcgcgtggacaccaag tcgcggggggcgtgggcccgccttctgcacgagcaccccaacgcgcgcaaatacaaagga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system