Equus asinus (ass): 106845583 Help Entry 106845583         CDS       T04645                                  Symbol GSTA4 Name (RefSeq) glutathione S-transferase A4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism eai  Equus asinus (ass) Pathway eai00480   Glutathione metabolism eai00980   Metabolism of xenobiotics by cytochrome P450 eai00982   Drug metabolism - cytochrome P450 eai00983   Drug metabolism - other enzymes eai01100   Metabolic pathways eai01524   Platinum drug resistance eai05200   Pathways in cancer eai05204   Chemical carcinogenesis - DNA adducts eai05207   Chemical carcinogenesis - receptor activation eai05208   Chemical carcinogenesis - reactive oxygen species eai05225   Hepatocellular carcinoma eai05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eai00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     106845583 (GSTA4)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     106845583 (GSTA4)    00982 Drug metabolism - cytochrome P450     106845583 (GSTA4)    00983 Drug metabolism - other enzymes     106845583 (GSTA4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106845583 (GSTA4)    05204 Chemical carcinogenesis - DNA adducts     106845583 (GSTA4)    05207 Chemical carcinogenesis - receptor activation     106845583 (GSTA4)    05208 Chemical carcinogenesis - reactive oxygen species     106845583 (GSTA4)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     106845583 (GSTA4)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     106845583 (GSTA4)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     106845583 (GSTA4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:eai02000]     106845583 (GSTA4) Enzymes [BR:eai01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      106845583 (GSTA4) Transporters [BR:eai02000]  Other transporters   Pores ion channels [TC:1]    106845583 (GSTA4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  106845583 NCBI-ProteinID:  XP_014719370 UniProt:  A0A8C4MMK7 LinkDB All DBs Position 8:complement(79714262..79730679) Genome browser AA seq 222 aa AA seqDB search MAAKPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKDQLQKLQDGNHLLFQQVPMVEI DGMKLVQTRSILHYIADKHHLFGKDLKERTLIDMYVEGTLDLLELIIMHPFLKPDDQQKE VVNMAQKAIIRYFPVFEKVLRDHGQRFLVGNQLSLADIILLQTILALEEKIPNILSAFPH LQEFTVKISNIPTIKKFLEPGSKKKPPPDDIYVRTVYNLFMP NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggcagcgaagcccaagctccattatccaaacgggagaggtcggatggaatccgtaaga tgggttttagccgctgctggagtcgagttcgatgaagaattcttagaaacaaaagatcag ctgcagaagttgcaggatggtaaccacctgttgttccaacaagtgccgatggttgaaatt gacgggatgaagctggtgcagacccgcagcatcctccactacatagcggacaagcaccac ctctttggcaaggacctcaaggagagaaccctgattgacatgtatgtggaggggacgctg gatctgctggaattgatcatcatgcatcctttcctaaaaccagatgatcagcaaaaagaa gtggtcaacatggcccagaaggctatcattagatactttcctgtgtttgaaaaggtctta agggatcacggacaaaggtttcttgttggtaatcagctgagcctcgcggacataattctt ctccaaaccattttggctctagaagagaaaattcctaatatcctgtctgcatttcctcac ctccaggagttcaccgtgaaaataagtaatatccctacaattaagaaatttcttgagcct ggtagcaagaagaagcctcctccggatgacatctacgtgagaaccgtctacaacctcttt atgccgtaa

DBGET integrated database retrieval system