KEGG   Equus asinus (ass): 106845632
Entry
106845632         CDS       T04645                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
eai  Equus asinus (ass)
Pathway
eai01521  EGFR tyrosine kinase inhibitor resistance
eai01522  Endocrine resistance
eai01524  Platinum drug resistance
eai04010  MAPK signaling pathway
eai04012  ErbB signaling pathway
eai04014  Ras signaling pathway
eai04015  Rap1 signaling pathway
eai04022  cGMP-PKG signaling pathway
eai04024  cAMP signaling pathway
eai04062  Chemokine signaling pathway
eai04066  HIF-1 signaling pathway
eai04068  FoxO signaling pathway
eai04071  Sphingolipid signaling pathway
eai04072  Phospholipase D signaling pathway
eai04114  Oocyte meiosis
eai04140  Autophagy - animal
eai04148  Efferocytosis
eai04150  mTOR signaling pathway
eai04151  PI3K-Akt signaling pathway
eai04210  Apoptosis
eai04218  Cellular senescence
eai04261  Adrenergic signaling in cardiomyocytes
eai04270  Vascular smooth muscle contraction
eai04350  TGF-beta signaling pathway
eai04360  Axon guidance
eai04370  VEGF signaling pathway
eai04371  Apelin signaling pathway
eai04380  Osteoclast differentiation
eai04510  Focal adhesion
eai04520  Adherens junction
eai04540  Gap junction
eai04550  Signaling pathways regulating pluripotency of stem cells
eai04611  Platelet activation
eai04613  Neutrophil extracellular trap formation
eai04620  Toll-like receptor signaling pathway
eai04621  NOD-like receptor signaling pathway
eai04625  C-type lectin receptor signaling pathway
eai04650  Natural killer cell mediated cytotoxicity
eai04657  IL-17 signaling pathway
eai04658  Th1 and Th2 cell differentiation
eai04659  Th17 cell differentiation
eai04660  T cell receptor signaling pathway
eai04662  B cell receptor signaling pathway
eai04664  Fc epsilon RI signaling pathway
eai04666  Fc gamma R-mediated phagocytosis
eai04668  TNF signaling pathway
eai04713  Circadian entrainment
eai04720  Long-term potentiation
eai04722  Neurotrophin signaling pathway
eai04723  Retrograde endocannabinoid signaling
eai04724  Glutamatergic synapse
eai04725  Cholinergic synapse
eai04726  Serotonergic synapse
eai04730  Long-term depression
eai04810  Regulation of actin cytoskeleton
eai04910  Insulin signaling pathway
eai04912  GnRH signaling pathway
eai04914  Progesterone-mediated oocyte maturation
eai04915  Estrogen signaling pathway
eai04916  Melanogenesis
eai04917  Prolactin signaling pathway
eai04919  Thyroid hormone signaling pathway
eai04921  Oxytocin signaling pathway
eai04926  Relaxin signaling pathway
eai04928  Parathyroid hormone synthesis, secretion and action
eai04929  GnRH secretion
eai04930  Type II diabetes mellitus
eai04933  AGE-RAGE signaling pathway in diabetic complications
eai04934  Cushing syndrome
eai04935  Growth hormone synthesis, secretion and action
eai04960  Aldosterone-regulated sodium reabsorption
eai05010  Alzheimer disease
eai05020  Prion disease
eai05022  Pathways of neurodegeneration - multiple diseases
eai05034  Alcoholism
eai05132  Salmonella infection
eai05133  Pertussis
eai05135  Yersinia infection
eai05140  Leishmaniasis
eai05142  Chagas disease
eai05145  Toxoplasmosis
eai05152  Tuberculosis
eai05160  Hepatitis C
eai05161  Hepatitis B
eai05163  Human cytomegalovirus infection
eai05164  Influenza A
eai05165  Human papillomavirus infection
eai05166  Human T-cell leukemia virus 1 infection
eai05167  Kaposi sarcoma-associated herpesvirus infection
eai05170  Human immunodeficiency virus 1 infection
eai05171  Coronavirus disease - COVID-19
eai05200  Pathways in cancer
eai05203  Viral carcinogenesis
eai05205  Proteoglycans in cancer
eai05206  MicroRNAs in cancer
eai05207  Chemical carcinogenesis - receptor activation
eai05208  Chemical carcinogenesis - reactive oxygen species
eai05210  Colorectal cancer
eai05211  Renal cell carcinoma
eai05212  Pancreatic cancer
eai05213  Endometrial cancer
eai05214  Glioma
eai05215  Prostate cancer
eai05216  Thyroid cancer
eai05218  Melanoma
eai05219  Bladder cancer
eai05220  Chronic myeloid leukemia
eai05221  Acute myeloid leukemia
eai05223  Non-small cell lung cancer
eai05224  Breast cancer
eai05225  Hepatocellular carcinoma
eai05226  Gastric cancer
eai05230  Central carbon metabolism in cancer
eai05231  Choline metabolism in cancer
eai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
eai05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106845632 (MAPK3)
   04012 ErbB signaling pathway
    106845632 (MAPK3)
   04014 Ras signaling pathway
    106845632 (MAPK3)
   04015 Rap1 signaling pathway
    106845632 (MAPK3)
   04350 TGF-beta signaling pathway
    106845632 (MAPK3)
   04370 VEGF signaling pathway
    106845632 (MAPK3)
   04371 Apelin signaling pathway
    106845632 (MAPK3)
   04668 TNF signaling pathway
    106845632 (MAPK3)
   04066 HIF-1 signaling pathway
    106845632 (MAPK3)
   04068 FoxO signaling pathway
    106845632 (MAPK3)
   04072 Phospholipase D signaling pathway
    106845632 (MAPK3)
   04071 Sphingolipid signaling pathway
    106845632 (MAPK3)
   04024 cAMP signaling pathway
    106845632 (MAPK3)
   04022 cGMP-PKG signaling pathway
    106845632 (MAPK3)
   04151 PI3K-Akt signaling pathway
    106845632 (MAPK3)
   04150 mTOR signaling pathway
    106845632 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106845632 (MAPK3)
   04148 Efferocytosis
    106845632 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    106845632 (MAPK3)
   04210 Apoptosis
    106845632 (MAPK3)
   04218 Cellular senescence
    106845632 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106845632 (MAPK3)
   04520 Adherens junction
    106845632 (MAPK3)
   04540 Gap junction
    106845632 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    106845632 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106845632 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    106845632 (MAPK3)
   04613 Neutrophil extracellular trap formation
    106845632 (MAPK3)
   04620 Toll-like receptor signaling pathway
    106845632 (MAPK3)
   04621 NOD-like receptor signaling pathway
    106845632 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    106845632 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    106845632 (MAPK3)
   04660 T cell receptor signaling pathway
    106845632 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    106845632 (MAPK3)
   04659 Th17 cell differentiation
    106845632 (MAPK3)
   04657 IL-17 signaling pathway
    106845632 (MAPK3)
   04662 B cell receptor signaling pathway
    106845632 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    106845632 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    106845632 (MAPK3)
   04062 Chemokine signaling pathway
    106845632 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106845632 (MAPK3)
   04929 GnRH secretion
    106845632 (MAPK3)
   04912 GnRH signaling pathway
    106845632 (MAPK3)
   04915 Estrogen signaling pathway
    106845632 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    106845632 (MAPK3)
   04917 Prolactin signaling pathway
    106845632 (MAPK3)
   04921 Oxytocin signaling pathway
    106845632 (MAPK3)
   04926 Relaxin signaling pathway
    106845632 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    106845632 (MAPK3)
   04919 Thyroid hormone signaling pathway
    106845632 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    106845632 (MAPK3)
   04916 Melanogenesis
    106845632 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106845632 (MAPK3)
   04270 Vascular smooth muscle contraction
    106845632 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    106845632 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    106845632 (MAPK3)
   04725 Cholinergic synapse
    106845632 (MAPK3)
   04726 Serotonergic synapse
    106845632 (MAPK3)
   04720 Long-term potentiation
    106845632 (MAPK3)
   04730 Long-term depression
    106845632 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    106845632 (MAPK3)
   04722 Neurotrophin signaling pathway
    106845632 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    106845632 (MAPK3)
   04380 Osteoclast differentiation
    106845632 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    106845632 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106845632 (MAPK3)
   05206 MicroRNAs in cancer
    106845632 (MAPK3)
   05205 Proteoglycans in cancer
    106845632 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    106845632 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    106845632 (MAPK3)
   05203 Viral carcinogenesis
    106845632 (MAPK3)
   05230 Central carbon metabolism in cancer
    106845632 (MAPK3)
   05231 Choline metabolism in cancer
    106845632 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106845632 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106845632 (MAPK3)
   05212 Pancreatic cancer
    106845632 (MAPK3)
   05225 Hepatocellular carcinoma
    106845632 (MAPK3)
   05226 Gastric cancer
    106845632 (MAPK3)
   05214 Glioma
    106845632 (MAPK3)
   05216 Thyroid cancer
    106845632 (MAPK3)
   05221 Acute myeloid leukemia
    106845632 (MAPK3)
   05220 Chronic myeloid leukemia
    106845632 (MAPK3)
   05218 Melanoma
    106845632 (MAPK3)
   05211 Renal cell carcinoma
    106845632 (MAPK3)
   05219 Bladder cancer
    106845632 (MAPK3)
   05215 Prostate cancer
    106845632 (MAPK3)
   05213 Endometrial cancer
    106845632 (MAPK3)
   05224 Breast cancer
    106845632 (MAPK3)
   05223 Non-small cell lung cancer
    106845632 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106845632 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    106845632 (MAPK3)
   05161 Hepatitis B
    106845632 (MAPK3)
   05160 Hepatitis C
    106845632 (MAPK3)
   05171 Coronavirus disease - COVID-19
    106845632 (MAPK3)
   05164 Influenza A
    106845632 (MAPK3)
   05163 Human cytomegalovirus infection
    106845632 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106845632 (MAPK3)
   05165 Human papillomavirus infection
    106845632 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106845632 (MAPK3)
   05135 Yersinia infection
    106845632 (MAPK3)
   05133 Pertussis
    106845632 (MAPK3)
   05152 Tuberculosis
    106845632 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106845632 (MAPK3)
   05140 Leishmaniasis
    106845632 (MAPK3)
   05142 Chagas disease
    106845632 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106845632 (MAPK3)
   05020 Prion disease
    106845632 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    106845632 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    106845632 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    106845632 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    106845632 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    106845632 (MAPK3)
   04934 Cushing syndrome
    106845632 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106845632 (MAPK3)
   01524 Platinum drug resistance
    106845632 (MAPK3)
   01522 Endocrine resistance
    106845632 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eai01001]
    106845632 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eai03036]
    106845632 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eai04147]
    106845632 (MAPK3)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106845632 (MAPK3)
Protein kinases [BR:eai01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106845632 (MAPK3)
Chromosome and associated proteins [BR:eai03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     106845632 (MAPK3)
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106845632 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 106845632
NCBI-ProteinID: XP_014719455
UniProt: A0A8C4PQ05
LinkDB
Position
14:complement(40099948..40106593)
AA seq 383 aa
MAAAAAAAAAQGGGGGEPRGADGVGPGVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMV
SSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFHHENVIGIRDILRAPTLEAMR
DVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINT
TCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILA
EMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLF
PKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLP
KERLKELIFQETARFQPGVLEAP
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggcggctcaggggggcgggggcggggagccccgggga
gctgatggggttggcccgggggtcccaggggaagtggaagtagtgaaggggcagccgttc
gacgtgggcccgcggtacacgcagctgcagtacatcggcgagggcgcgtacggcatggtc
agctcagcttacgaccatgtgcgcaagactcgagtggccatcaagaaaatcagccccttc
gagcatcagacctactgccagcgcacgctgcgggagatccagatcttgctgcgcttccac
catgaaaatgtcattggcatccgagacattctgcgggcacccaccctggaagccatgagg
gatgtctacattgtgcaggacctgatggagacagacctgtacaagttgctcaaaagccag
cagctgagcaacgaccacatctgctatttcctttaccagatccttcggggcctcaagtat
atccactcagccaacgtgctccaccgggatttaaaaccctccaacctgctcatcaacacc
acctgtgaccttaagatctgcgattttggccttgcccggatcgccgatcctgagcacgac
cacaccggcttcctgacagaatacgtggccactcgctggtaccgggccccagaaatcatg
cttaactccaagggctataccaagtccatcgacatctggtctgtgggttgcattttggct
gagatgctttccaaccggcccatattccctggcaagcactacctggaccagctcaaccac
attctgggtatcctcggttccccatcccaggaggacctgaattgtatcatcaacatgaag
gctcgaaactacctacagtctctgccctccaagaccaaggtggcctgggccaagcttttc
cccaagtcagactccaaagcccttgacctactggaccggatgttgacctttaaccccaac
aaacggatcacagtggaggaagcgctggctcacccctacctggagcagtactatgaccca
acggatgagccagtggcggaagaacctttcacctttgacatggagctggatgatctacca
aaggagcggctgaaggagctcatcttccaggaaacagcccgcttccagcctggggtgctg
gaggccccctaa

DBGET integrated database retrieval system