Equus asinus (ass): 106846749
Help
Entry
106846749 CDS
T04645
Symbol
NDUFB8
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
KO
K03964
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8
Organism
eai
Equus asinus (ass)
Pathway
eai00190
Oxidative phosphorylation
eai01100
Metabolic pathways
eai04714
Thermogenesis
eai04723
Retrograde endocannabinoid signaling
eai04932
Non-alcoholic fatty liver disease
eai05010
Alzheimer disease
eai05012
Parkinson disease
eai05014
Amyotrophic lateral sclerosis
eai05016
Huntington disease
eai05020
Prion disease
eai05022
Pathways of neurodegeneration - multiple diseases
eai05208
Chemical carcinogenesis - reactive oxygen species
eai05415
Diabetic cardiomyopathy
Module
eai_M00147
NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:
eai00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
106846749 (NDUFB8)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
106846749 (NDUFB8)
09159 Environmental adaptation
04714 Thermogenesis
106846749 (NDUFB8)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
106846749 (NDUFB8)
09164 Neurodegenerative disease
05010 Alzheimer disease
106846749 (NDUFB8)
05012 Parkinson disease
106846749 (NDUFB8)
05014 Amyotrophic lateral sclerosis
106846749 (NDUFB8)
05016 Huntington disease
106846749 (NDUFB8)
05020 Prion disease
106846749 (NDUFB8)
05022 Pathways of neurodegeneration - multiple diseases
106846749 (NDUFB8)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
106846749 (NDUFB8)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
106846749 (NDUFB8)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
NDUF_B8
Motif
Other DBs
NCBI-GeneID:
106846749
NCBI-ProteinID:
XP_014721215
UniProt:
A0A9L0I900
LinkDB
All DBs
Position
2:75499568..75504385
Genome browser
AA seq
186 aa
AA seq
DB search
MAAARAGVLGVRWLQRAARNVVPLGARTASHITKDMLPGPYPKTPEERAAAAKKYNMRVE
DYEPYPDDGMGYGDYPKLPDRSQQERDPWYDWDHPDLRLNWGEPMHWDLDMYIRNRVDTS
PTPVSWNLMCKHLFGFVAFMIFMFWVGDTYPTYQPVGPKQYPYNNLYLERGGDPTKEPEP
VVHYEI
NT seq
561 nt
NT seq
+upstream
nt +downstream
nt
atggcggcggccagggccggggtcctgggagtccgatggctgcaaagggcagcccggaac
gtggtgccgttgggtgcacggacagcctcccacattaccaaggatatgctcccgggaccc
tatcccaagaccccagaagaacgggcggccgctgccaagaagtataacatgcgggtggaa
gactatgagccatacccggatgatggcatggggtatggcgactacccgaagctccctgac
cgctcacagcaggagagggatccatggtatgactgggaccacccagatctgaggctgaac
tggggtgaaccgatgcactgggacctagacatgtatatcaggaaccgtgtggacacgtct
cccacgcctgtttcttggaatctcatgtgtaagcatctcttcggctttgtggccttcatg
atcttcatgttttgggttggggacacttaccccacctaccagcccgtggggccaaagcag
tatccttacaataatctgtacctggaacgaggcggtgatcccactaaagagcctgagccg
gtggttcactatgagatctga
DBGET
integrated database retrieval system