Equus asinus (ass): 106847095 Help Entry 106847095         CDS       T04645                                  Symbol APLN Name (RefSeq) apelin   KO K05225   apelin Organism eai  Equus asinus (ass) Pathway eai04080   Neuroactive ligand-receptor interaction eai04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     106847095 (APLN)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     106847095 (APLN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eai04052]     106847095 (APLN) Cytokines and neuropeptides [BR:eai04052]  Neuropeptides   GPCR binding    106847095 (APLN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apelin Motif Other DBs NCBI-GeneID:  106847095 NCBI-ProteinID:  XP_044620008 UniProt:  A0A8C4LEZ6 LinkDB All DBs Position X:82848842..82857942 Genome browser AA seq 77 aa AA seqDB search MDLRLCVQALLLLWLSLTAVCGGPLLQPPDGQGLEEGDVRYLVQPRGSRNGPGPWQGGRR KFRRQRPRLSHKGPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggatctgcggctctgcgtgcaggcgctcctgctgctctggctctccctgacggcggtg tgcggagggcccctgctgcagcctcctgacgggcaggggctggaggaaggcgatgtccgc tacctggtgcagcccagagggtcgagaaacggaccagggccctggcagggagggcggagg aaattccgccgccagcggccgcgcctctcccataagggccccatgcctttctga

DBGET integrated database retrieval system