KEGG   Equus asinus (ass): 106847177
Entry
106847177         CDS       T04645                                 
Symbol
CALML4
Name
(RefSeq) calmodulin-like protein 4 isoform X2
  KO
K02183  calmodulin
Organism
eai  Equus asinus (ass)
Pathway
eai04014  Ras signaling pathway
eai04015  Rap1 signaling pathway
eai04020  Calcium signaling pathway
eai04022  cGMP-PKG signaling pathway
eai04024  cAMP signaling pathway
eai04070  Phosphatidylinositol signaling system
eai04114  Oocyte meiosis
eai04218  Cellular senescence
eai04261  Adrenergic signaling in cardiomyocytes
eai04270  Vascular smooth muscle contraction
eai04371  Apelin signaling pathway
eai04625  C-type lectin receptor signaling pathway
eai04713  Circadian entrainment
eai04720  Long-term potentiation
eai04722  Neurotrophin signaling pathway
eai04728  Dopaminergic synapse
eai04740  Olfactory transduction
eai04744  Phototransduction
eai04750  Inflammatory mediator regulation of TRP channels
eai04910  Insulin signaling pathway
eai04912  GnRH signaling pathway
eai04915  Estrogen signaling pathway
eai04916  Melanogenesis
eai04921  Oxytocin signaling pathway
eai04922  Glucagon signaling pathway
eai04924  Renin secretion
eai04925  Aldosterone synthesis and secretion
eai04970  Salivary secretion
eai04971  Gastric acid secretion
eai05010  Alzheimer disease
eai05012  Parkinson disease
eai05022  Pathways of neurodegeneration - multiple diseases
eai05031  Amphetamine addiction
eai05034  Alcoholism
eai05133  Pertussis
eai05152  Tuberculosis
eai05163  Human cytomegalovirus infection
eai05167  Kaposi sarcoma-associated herpesvirus infection
eai05170  Human immunodeficiency virus 1 infection
eai05200  Pathways in cancer
eai05214  Glioma
eai05417  Lipid and atherosclerosis
eai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106847177 (CALML4)
   04015 Rap1 signaling pathway
    106847177 (CALML4)
   04371 Apelin signaling pathway
    106847177 (CALML4)
   04020 Calcium signaling pathway
    106847177 (CALML4)
   04070 Phosphatidylinositol signaling system
    106847177 (CALML4)
   04024 cAMP signaling pathway
    106847177 (CALML4)
   04022 cGMP-PKG signaling pathway
    106847177 (CALML4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106847177 (CALML4)
   04218 Cellular senescence
    106847177 (CALML4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106847177 (CALML4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106847177 (CALML4)
   04922 Glucagon signaling pathway
    106847177 (CALML4)
   04912 GnRH signaling pathway
    106847177 (CALML4)
   04915 Estrogen signaling pathway
    106847177 (CALML4)
   04921 Oxytocin signaling pathway
    106847177 (CALML4)
   04916 Melanogenesis
    106847177 (CALML4)
   04924 Renin secretion
    106847177 (CALML4)
   04925 Aldosterone synthesis and secretion
    106847177 (CALML4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106847177 (CALML4)
   04270 Vascular smooth muscle contraction
    106847177 (CALML4)
  09154 Digestive system
   04970 Salivary secretion
    106847177 (CALML4)
   04971 Gastric acid secretion
    106847177 (CALML4)
  09156 Nervous system
   04728 Dopaminergic synapse
    106847177 (CALML4)
   04720 Long-term potentiation
    106847177 (CALML4)
   04722 Neurotrophin signaling pathway
    106847177 (CALML4)
  09157 Sensory system
   04744 Phototransduction
    106847177 (CALML4)
   04740 Olfactory transduction
    106847177 (CALML4)
   04750 Inflammatory mediator regulation of TRP channels
    106847177 (CALML4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    106847177 (CALML4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106847177 (CALML4)
  09162 Cancer: specific types
   05214 Glioma
    106847177 (CALML4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106847177 (CALML4)
   05163 Human cytomegalovirus infection
    106847177 (CALML4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106847177 (CALML4)
  09171 Infectious disease: bacterial
   05133 Pertussis
    106847177 (CALML4)
   05152 Tuberculosis
    106847177 (CALML4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106847177 (CALML4)
   05012 Parkinson disease
    106847177 (CALML4)
   05022 Pathways of neurodegeneration - multiple diseases
    106847177 (CALML4)
  09165 Substance dependence
   05031 Amphetamine addiction
    106847177 (CALML4)
   05034 Alcoholism
    106847177 (CALML4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    106847177 (CALML4)
   05418 Fluid shear stress and atherosclerosis
    106847177 (CALML4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eai01009]
    106847177 (CALML4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eai04131]
    106847177 (CALML4)
   03036 Chromosome and associated proteins [BR:eai03036]
    106847177 (CALML4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eai04147]
    106847177 (CALML4)
Protein phosphatases and associated proteins [BR:eai01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     106847177 (CALML4)
Membrane trafficking [BR:eai04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    106847177 (CALML4)
Chromosome and associated proteins [BR:eai03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     106847177 (CALML4)
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106847177 (CALML4)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_9 EF-hand_11
Other DBs
NCBI-GeneID: 106847177
NCBI-ProteinID: XP_014721834
LinkDB
Position
2:169354134..169367108
AA seq 117 aa
MRCLGASPTPGEVQRHLQTHGLDRNGELDFSTFLTIMHMQIKQEDPKKEILLAMLMADKE
KKGYIMASELRSKLMQLGEKLTHKEVDELFREANIEPNGKVKYDEFIRKITIPVQDY
NT seq 354 nt   +upstreamnt  +downstreamnt
atgcggtgcctgggggccagcccgacgccgggggaggtgcagcggcacctgcagacgcac
gggctggacagaaatggagagctggatttctccactttcctgaccattatgcacatgcaa
atcaaacaagaggacccaaagaaagaaattctattggccatgttgatggcagacaaggag
aagaaaggctacatcatggcgtccgagctgcggtcaaaactcatgcaacttggggagaag
ctcacccacaaggaagtcgatgagcttttccgcgaagcaaatatcgaaccaaatggcaaa
gtgaagtatgatgaatttatccgcaagatcacgattcctgtgcaggactactga

DBGET integrated database retrieval system