Equus asinus (ass): 106847316 Help Entry 106847316         CDS       T04645                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism eai  Equus asinus (ass) Pathway eai04146   Peroxisome eai04213   Longevity regulating pathway - multiple species eai05012   Parkinson disease eai05014   Amyotrophic lateral sclerosis eai05016   Huntington disease eai05020   Prion disease eai05022   Pathways of neurodegeneration - multiple diseases eai05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:eai00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     106847316 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     106847316 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     106847316 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     106847316 (SOD1)    05014 Amyotrophic lateral sclerosis     106847316 (SOD1)    05016 Huntington disease     106847316 (SOD1)    05020 Prion disease     106847316 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     106847316 (SOD1) Enzymes [BR:eai01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      106847316 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  106847316 NCBI-ProteinID:  XP_014722020 UniProt:  A0A9L0KM33 LinkDB All DBs Position 18:complement(19335195..19342405) Genome browser AA seq 154 aa AA seqDB search MALKAVCVLKGDGPVHGVIHFEQQQEGGPVVLKGFIEGLTKGDHGFHVHEFGDNTQGCTT AGAHFNPLSKKHGGPKDEERHVGDLGNVTADENGKADVDMKDPVISLSGKHSIIGRTMVV HEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggcgctgaaggccgtgtgcgtgctgaagggcgacggcccggtgcacggcgtcatccac ttcgagcagcagcaggaaggtgggcccgtcgttctgaagggattcattgaaggattaacc aaaggcgatcacggattccacgtccacgagtttggagataatacacaaggctgtaccact gctggtgctcactttaatcctctgtcgaaaaaacacggtggaccaaaggacgaagagagg catgttggagacctgggcaatgtgactgctgatgaaaatggtaaggctgatgtggatatg aaagatcctgtgatctcgctctcgggaaagcattccatcattggccgcacaatggtggtc cacgagaaacaagatgacctgggcaaaggtggaaacgaagaaagtacaaagacggggaac gctggcagtcgtctggcttgtggtgtgattgggatcgctcagtaa

DBGET integrated database retrieval system