Equus asinus (ass): 123279402 Help Entry 123279402         CDS       T04645                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism eai  Equus asinus (ass) Pathway eai04015   Rap1 signaling pathway eai04810   Regulation of actin cytoskeleton eai05014   Amyotrophic lateral sclerosis eai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     123279402 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     123279402 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123279402 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     123279402 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eai04131]     123279402 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:eai04812]     123279402 (PFN2)    04147 Exosome [BR:eai04147]     123279402 (PFN2) Membrane trafficking [BR:eai04131]  Others   Actin-binding proteins    Others     123279402 (PFN2) Cytoskeleton proteins [BR:eai04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      123279402 (PFN2) Exosome [BR:eai04147]  Exosomal proteins   Proteins found in most exosomes    123279402 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  123279402 NCBI-ProteinID:  XP_044610608 LinkDB All DBs Position 21:14132380..14137927 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtgtgggccgccacggccgggggcgtcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc gatggtgactgcacgatggacatccggacgaagagtcaaggtggggagccaacatacaac gttgccgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system