Equus asinus (ass): 123286693 Help Entry 123286693         CDS       T04645                                  Name (RefSeq) interleukin-1 beta-like   KO K04519   interleukin 1 beta Organism eai  Equus asinus (ass) Pathway eai01523   Antifolate resistance eai04010   MAPK signaling pathway eai04060   Cytokine-cytokine receptor interaction eai04064   NF-kappa B signaling pathway eai04217   Necroptosis eai04380   Osteoclast differentiation eai04620   Toll-like receptor signaling pathway eai04621   NOD-like receptor signaling pathway eai04623   Cytosolic DNA-sensing pathway eai04625   C-type lectin receptor signaling pathway eai04640   Hematopoietic cell lineage eai04657   IL-17 signaling pathway eai04659   Th17 cell differentiation eai04668   TNF signaling pathway eai04750   Inflammatory mediator regulation of TRP channels eai04932   Non-alcoholic fatty liver disease eai04933   AGE-RAGE signaling pathway in diabetic complications eai04936   Alcoholic liver disease eai04940   Type I diabetes mellitus eai05010   Alzheimer disease eai05020   Prion disease eai05022   Pathways of neurodegeneration - multiple diseases eai05132   Salmonella infection eai05133   Pertussis eai05134   Legionellosis eai05135   Yersinia infection eai05140   Leishmaniasis eai05142   Chagas disease eai05143   African trypanosomiasis eai05144   Malaria eai05146   Amoebiasis eai05152   Tuberculosis eai05162   Measles eai05163   Human cytomegalovirus infection eai05164   Influenza A eai05168   Herpes simplex virus 1 infection eai05171   Coronavirus disease - COVID-19 eai05321   Inflammatory bowel disease eai05323   Rheumatoid arthritis eai05332   Graft-versus-host disease eai05417   Lipid and atherosclerosis eai05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123286693    04064 NF-kappa B signaling pathway     123286693    04668 TNF signaling pathway     123286693   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123286693  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     123286693  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     123286693    04620 Toll-like receptor signaling pathway     123286693    04621 NOD-like receptor signaling pathway     123286693    04623 Cytosolic DNA-sensing pathway     123286693    04625 C-type lectin receptor signaling pathway     123286693    04659 Th17 cell differentiation     123286693    04657 IL-17 signaling pathway     123286693   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     123286693   09158 Development and regeneration    04380 Osteoclast differentiation     123286693  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     123286693    05164 Influenza A     123286693    05162 Measles     123286693    05168 Herpes simplex virus 1 infection     123286693    05163 Human cytomegalovirus infection     123286693   09171 Infectious disease: bacterial    05132 Salmonella infection     123286693    05135 Yersinia infection     123286693    05133 Pertussis     123286693    05134 Legionellosis     123286693    05152 Tuberculosis     123286693   09174 Infectious disease: parasitic    05146 Amoebiasis     123286693    05144 Malaria     123286693    05140 Leishmaniasis     123286693    05142 Chagas disease     123286693    05143 African trypanosomiasis     123286693   09163 Immune disease    05323 Rheumatoid arthritis     123286693    05321 Inflammatory bowel disease     123286693    05332 Graft-versus-host disease     123286693   09164 Neurodegenerative disease    05010 Alzheimer disease     123286693    05020 Prion disease     123286693    05022 Pathways of neurodegeneration - multiple diseases     123286693   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123286693    05418 Fluid shear stress and atherosclerosis     123286693   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     123286693    04936 Alcoholic liver disease     123286693    04932 Non-alcoholic fatty liver disease     123286693    04933 AGE-RAGE signaling pathway in diabetic complications     123286693   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     123286693  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eai04052]     123286693    00536 Glycosaminoglycan binding proteins [BR:eai00536]     123286693 Cytokines and neuropeptides [BR:eai04052]  Cytokines   Interleukins    123286693 Glycosaminoglycan binding proteins [BR:eai00536]  Heparan sulfate / Heparin   Cytokines    123286693 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  123286693 NCBI-ProteinID:  XP_044628773 LinkDB All DBs Position 6:77244414..77250780 Genome browser AA seq 270 aa AA seqDB search MAAVPDTSDMMTYCSGNENDLFFEEDGPKQMKGSFQDLDLSSTGDGGIQLQFSHQLYNKT FKHVVSIIVAMEKLKKIPVPVPCSQAFQDDDLRSLFSVIFEEEPIICDNWDDDYVCDAAV HSVNCRLRDIYHKSLVLSGACELQAVHLNGENTNQQVVFCMSFVQGEEETDKIPVALGLK EKNLYLSCGMKDGKPTLQLETVDPNTYPKRKMEKRFVFNKMEIKGNVEFESAMYPNWYIS TSQAEKKPVFLGNTRGGRDITDFIMEITSA NT seq 813 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtacccgacaccagtgacatgatgacttactgcagcggcaatgagaatgac ctgttctttgaggaggatggcccaaaacagatgaagggcagcttccaagacctggacctc agctccacaggagatgggggcatccagcttcaattctcccaccaactttacaataagact ttcaagcatgtcgtgtcaatcattgtggctatggagaagctgaagaagatacccgttccc gttccctgctcacaggccttccaggatgatgacttgaggagcctcttttctgtcatcttt gaagaagaacccatcatctgtgacaactgggatgatgattatgtgtgtgatgcagctgtg cattcagtgaactgcagactccgggacatataccataaatccctggtgctgtccggtgca tgtgagctgcaggctgtccacctcaatggagagaatacaaaccaacaagtggtgttctgc atgagctttgtgcaaggagaagaagagactgacaagatacctgtggccttgggcctcaag gaaaagaacctgtacctgtcttgtgggatgaaagatgggaagcccaccctacagctggag acagtagaccccaatacttacccaaagaggaaaatggaaaagcgatttgtcttcaacaag atggaaatcaagggcaacgtggaatttgagtctgcaatgtaccccaactggtacatcagc acctctcaagcagaaaaaaaacccgtcttcctaggaaataccagaggcggccgggacata actgacttcatcatggaaatcacctctgcctaa

DBGET integrated database retrieval system