Candidatus Electrothrix aestuarii: Q3M24_06690 Help Entry Q3M24_06690       CDS       T10293                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eaj  Candidatus Electrothrix aestuarii Pathway eaj01100   Metabolic pathways eaj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eaj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Q3M24_06690    00074 Mycolic acid biosynthesis     Q3M24_06690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Q3M24_06690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding VapC50_C dCache_2 Motif Other DBs NCBI-ProteinID:  XCN74427 UniProt:  A0AAU8LZW4 LinkDB All DBs Position complement(1438590..1438841) Genome browser AA seq 83 aa AA seqDB search MTRDEIKDIILEIIEDIDEDADFDSLDADQPLRDQLDLDSMDFLDIVMELRKRYKLQIPE EDYPELATLTSCVNYLEPKLQDA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacccgtgatgaaatcaaggatataatccttgaaattattgaagacatagatgaggat gcggattttgacagtttggatgcggatcagcctctccgagatcagttagaccttgattca atggattttcttgatatcgtgatggagctgcggaaacgctacaagctgcagatcccggag gaggattatcctgaactcgccaccctgaccagctgtgtcaattatcttgaaccgaaattg caagacgcctga

DBGET integrated database retrieval system