Candidatus Electrothrix aestuarii: Q3M24_08280 Help Entry Q3M24_08280       CDS       T10293                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eaj  Candidatus Electrothrix aestuarii Pathway eaj01100   Metabolic pathways eaj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eaj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Q3M24_08280 (acpP)    00074 Mycolic acid biosynthesis     Q3M24_08280 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Q3M24_08280 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  XCN74725 UniProt:  A0AAU8LYT2 LinkDB All DBs Position 1782275..1782508 Genome browser AA seq 77 aa AA seqDB search MAVSEKMIDIIEEQLSVDKDKIVPGAAFVDDLGADSLDLVELIMAMEEEFDVEIPDEDAE KIATVQDAIDYVDKIQG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagtctcagagaaaatgatcgacattattgaagagcaactcagtgttgataaggat aaaatcgttcccggtgcagcttttgtagatgaccttggagcggattcccttgatctggtt gaactgatcatggctatggaagaagagtttgatgttgagattcctgatgaggatgcagag aagattgcaactgttcaggatgcgatagactacgttgataagatccagggataa

DBGET integrated database retrieval system