Candidatus Electrothrix aestuarii: Q3M24_17650 Help Entry Q3M24_17650       CDS       T10293                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism eaj  Candidatus Electrothrix aestuarii Pathway eaj00020   Citrate cycle (TCA cycle) eaj00720   Other carbon fixation pathways eaj01100   Metabolic pathways eaj01110   Biosynthesis of secondary metabolites eaj01120   Microbial metabolism in diverse environments eaj01200   Carbon metabolism eaj01210   2-Oxocarboxylic acid metabolism Module eaj_M00009   Citrate cycle (TCA cycle, Krebs cycle) eaj_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:eaj00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Q3M24_17650   09102 Energy metabolism    00720 Other carbon fixation pathways     Q3M24_17650 Enzymes [BR:eaj01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Q3M24_17650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_8 Fer4_4 Fer4_6 Fer4_22 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  XCN72116 UniProt:  A0AAU8LT99 LinkDB All DBs Position 3857125..3857364 Genome browser AA seq 79 aa AA seqDB search MKNTGKKKQFDVSFYHDWCKSCGICMAFCPQKIIHPGKEGKPEILDKDGCVGCRFCEMHC PDFAITVAERKASRGRDND NT seq 240 nt NT seq  +upstreamnt  +downstreamnt ttgaagaacacaggaaaaaagaagcagtttgacgtctctttttatcatgattggtgcaaa agctgcggtatctgcatggccttctgtcctcagaaaattattcaccccggcaaagaagga aaaccggagatccttgataaagatggctgcgtgggatgccgcttctgcgaaatgcattgc ccggattttgccataacagtcgcagaacgcaaggcgagcagaggacgggataatgactga

DBGET integrated database retrieval system