KEGG   Sinorhizobium alkalisoli: EKH55_0121
Entry
EKH55_0121        CDS       T06241                                 
Name
(GenBank) Phosphate regulon transcriptional regulatory protein PhoB (SphR)
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
eak  Sinorhizobium alkalisoli
Pathway
eak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eak00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EKH55_0121
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eak02022]
    EKH55_0121
Two-component system [BR:eak02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   EKH55_0121
SSDB
Motif
Pfam: Trans_reg_C Response_reg GerE
Other DBs
NCBI-ProteinID: QFI64995
LinkDB
Position
1:125127..125810
AA seq 227 aa
MLPKIAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQERLPDLLILDWMLPGVS
GIELCRRLRQRPETERLPIIMLTARGEESERVRGLATGADDYVVKPFSTPELMARVKAML
RRAKPEVLSTVLRCGDIELDRETHRVHRRSREVRLGPTEFRLLEFLMSSPGRVFSRSQLL
DGVWGHDIYVDERTVDVHVGRLRKALNLSNMPDVIRTVRGAGYSLEG
NT seq 684 nt   +upstreamnt  +downstreamnt
atgttgccgaagatagctgttgtcgaagacgaggaggcgctgagcgtgctgctgcgctac
aacctcgaagccgagggcttcgaggtcgatactattcttcgcggcgacgaggctgaaatc
cgcctgcaggaacgtctgcccgacctcttgatcctcgactggatgttgcccggcgtttcc
ggcatcgagctttgccgcagacttcgacaaagaccggaaacggagcggttgccgatcatc
atgctgacggcgcgcggcgaggaaagcgagcgcgtgcgagggctcgcgaccggcgccgac
gactatgtcgtcaagccgttttcgactccggaactgatggcgcgggtcaaggcgatgttg
aggcgcgccaaaccggaggtcctgtcgacggtgctccgctgcggcgacatcgaactcgac
cgcgagacgcatcgcgtccatcgccgcagccgtgaggttcggctcgggccgacggagttc
cggctgctggagtttctgatgtcttcgccgggacgcgtcttttcccgctcgcaactgctt
gacggtgtctggggccacgacatctacgtggacgaacgcacggtcgatgtccatgtcggc
cgcctgcgcaaggcgctgaacctctccaacatgcccgacgtgatcaggacggtgcgcggc
gccggctactcgctcgaggggtaa

DBGET integrated database retrieval system