Sinorhizobium alkalisoli: EKH55_0777 Help Entry EKH55_0777        CDS       T06241                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism eak  Sinorhizobium alkalisoli Pathway eak00998   Biosynthesis of various antibiotics eak01100   Metabolic pathways eak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EKH55_0777    00074 Mycolic acid biosynthesis     EKH55_0777   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EKH55_0777 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  QFI65651 LinkDB All DBs Position 1:771339..771575 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtgaagaaaattgttattgatcatcttggcgtcgacgcc gaaaaggtcagcgaaggcgcaagcttcatcgatgacctcggcgcggactcgctcgacacg gtcgaactggtcatggcattcgaagaagaattcggtgtcgagatcccggacgacgctgcg gactcgatcctgaccgtcggcgacgccgtcaagttcatcgagaaggctcaggcctga

DBGET integrated database retrieval system