KEGG   Escherichia albertii: EAKF1_ch0720
Entry
EAKF1_ch0720      CDS       T03986                                 
Symbol
gpmA
Name
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eal  Escherichia albertii
Pathway
eal00010  Glycolysis / Gluconeogenesis
eal00260  Glycine, serine and threonine metabolism
eal00680  Methane metabolism
eal01100  Metabolic pathways
eal01110  Biosynthesis of secondary metabolites
eal01120  Microbial metabolism in diverse environments
eal01200  Carbon metabolism
eal01230  Biosynthesis of amino acids
Module
eal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eal_M00002  Glycolysis, core module involving three-carbon compounds
eal_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAKF1_ch0720 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    EAKF1_ch0720 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAKF1_ch0720 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eal04131]
    EAKF1_ch0720 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eal04147]
    EAKF1_ch0720 (gpmA)
Enzymes [BR:eal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EAKF1_ch0720 (gpmA)
Membrane trafficking [BR:eal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EAKF1_ch0720 (gpmA)
Exosome [BR:eal04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EAKF1_ch0720 (gpmA)
  Exosomal proteins of melanoma cells
   EAKF1_ch0720 (gpmA)
SSDB
Motif
Pfam: His_Phos_1 Hda_lid
Other DBs
NCBI-ProteinID: AHE58629
LinkDB
Position
750840..751592
AA seq 250 aa
MTVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt   +upstreamnt  +downstreamnt
atgactgtaactaagctggttctggttcgtcacggcgaaagtcagtggaacaaagaaaac
cgctttactggttggtatgatgtagatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggcaaactgctgaaagaggaaggttacagctttgactttgcttacacctccgtcctg
aaacgtgcaatccatactctgtggaacgtactggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactcaacgaacgtcattacggtgcgttgcaggggctgaacaaa
gcggaaaccgcagaaaaatatggcgacgagcaggtgaaacagtggcgtcgtggttttgcg
gtgactccgccggaactgactaaagatgatgaacgttacccgggacacgatccgcgttat
gctaagttgagcgagaaagagttaccgctgactgaaagcctggcgttgactattgaccgg
gtaattccttactggaatgaaactattctcccgcgcatgaagagcggagagcgcgtgatc
atcgctgcccatggtaactctctgcgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagttgaatattccgactggcgtaccgctggtttatgaattcgacgag
aacttcaaaccactgaaacgttactacctgggtaatgctgacgaaatcgcggcgaaagct
gcggcagtagccaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system