Escherichia albertii: EAKF1_ch0734c Help Entry EAKF1_ch0734c     CDS       T03986                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism eal  Escherichia albertii Pathway eal00190   Oxidative phosphorylation eal01100   Metabolic pathways eal02020   Two-component system Module eal_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:eal00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     EAKF1_ch0734c  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     EAKF1_ch0734c Enzymes [BR:eal01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      EAKF1_ch0734c BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AHE58643 LinkDB All DBs Position complement(763415..763528) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgttcatttggggtaatcacc gcgctggcgcttgagcacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system